Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FQS8

Protein Details
Accession Q6FQS8   
Localization Confidence High
Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSNSKIKIKKNKKNGKSLKQLHKALSHydrophilic
NLS Segment(s)
PositionSequence
5-26KIKIKKNKKNGKSLKQLHKALS
31-38KDNKPQKK
44-45KK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018465  Scm3/HJURP  
Gene Ontology GO:0000779  C:condensed chromosome, centromeric region  
GO:0005634  C:nucleus  
GO:0097030  F:CENP-A containing nucleosome binding  
GO:0042393  F:histone binding  
GO:0007059  P:chromosome segregation  
GO:0000086  P:G2/M transition of mitotic cell cycle  
GO:0051382  P:kinetochore assembly  
GO:2000059  P:negative regulation of ubiquitin-dependent protein catabolic process  
GO:0071459  P:protein localization to chromosome, centromeric region  
KEGG cgr:CAGL0I03850g  -  
Pfam View protein in Pfam  
PF10384  Scm3  
Amino Acid Sequences MSNSKIKIKKNKKNGKSLKQLHKALSGLLQKDNKPQKKDVSIDKKHSKRENSCERGSKDDPYKEVKKKNGRAYIYSKENQLIPKLTDEEVMEKHKLADQRMKTVWSNIIDKYSNVVDEGDVIDLQSGEIITDNGHIRNLNTGFTSSRGKETRYTSVVKDILLDENVPAHDSYDEYSIWEDNNAEEEEAVFTDPEEPLTSESE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.91
3 0.91
4 0.91
5 0.9
6 0.89
7 0.86
8 0.78
9 0.73
10 0.63
11 0.53
12 0.5
13 0.45
14 0.37
15 0.39
16 0.4
17 0.36
18 0.45
19 0.54
20 0.55
21 0.54
22 0.57
23 0.59
24 0.62
25 0.66
26 0.67
27 0.68
28 0.69
29 0.73
30 0.78
31 0.76
32 0.77
33 0.8
34 0.78
35 0.76
36 0.78
37 0.79
38 0.76
39 0.76
40 0.76
41 0.71
42 0.69
43 0.62
44 0.59
45 0.55
46 0.52
47 0.48
48 0.48
49 0.54
50 0.54
51 0.58
52 0.61
53 0.63
54 0.68
55 0.74
56 0.75
57 0.69
58 0.67
59 0.67
60 0.64
61 0.61
62 0.54
63 0.46
64 0.39
65 0.38
66 0.34
67 0.29
68 0.24
69 0.18
70 0.18
71 0.19
72 0.18
73 0.17
74 0.16
75 0.16
76 0.16
77 0.18
78 0.16
79 0.14
80 0.14
81 0.15
82 0.17
83 0.18
84 0.23
85 0.21
86 0.26
87 0.27
88 0.29
89 0.27
90 0.27
91 0.27
92 0.23
93 0.23
94 0.19
95 0.21
96 0.19
97 0.18
98 0.19
99 0.15
100 0.13
101 0.11
102 0.1
103 0.07
104 0.07
105 0.08
106 0.06
107 0.05
108 0.05
109 0.05
110 0.04
111 0.04
112 0.04
113 0.03
114 0.03
115 0.03
116 0.03
117 0.04
118 0.06
119 0.07
120 0.08
121 0.09
122 0.09
123 0.09
124 0.15
125 0.16
126 0.14
127 0.14
128 0.15
129 0.15
130 0.17
131 0.22
132 0.17
133 0.24
134 0.24
135 0.26
136 0.3
137 0.34
138 0.39
139 0.38
140 0.4
141 0.35
142 0.4
143 0.39
144 0.33
145 0.3
146 0.24
147 0.23
148 0.2
149 0.19
150 0.12
151 0.13
152 0.13
153 0.13
154 0.11
155 0.1
156 0.09
157 0.1
158 0.11
159 0.11
160 0.11
161 0.11
162 0.12
163 0.12
164 0.12
165 0.13
166 0.12
167 0.1
168 0.13
169 0.13
170 0.12
171 0.11
172 0.11
173 0.11
174 0.12
175 0.12
176 0.08
177 0.08
178 0.09
179 0.09
180 0.1
181 0.11
182 0.12