Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2G008

Protein Details
Accession A0A0D2G008    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
95-124AELTVRCPNSKRPWKRPSPKHPLSWNSPACHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 10, cyto 8.5, mito 5
Family & Domain DBs
Amino Acid Sequences MSAPVLTIAFEPEGWPYQSVSSSRRSSSACAISHHASASQPNQIPEQPEHERWLYLKVQALNYRLLARTDLDGIHEALRIATLLWILSITEYVGAELTVRCPNSKRPWKRPSPKHPLSWNSPACISG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.15
5 0.18
6 0.21
7 0.21
8 0.26
9 0.28
10 0.28
11 0.31
12 0.31
13 0.31
14 0.35
15 0.39
16 0.33
17 0.32
18 0.36
19 0.34
20 0.34
21 0.31
22 0.25
23 0.18
24 0.2
25 0.19
26 0.21
27 0.2
28 0.21
29 0.22
30 0.23
31 0.25
32 0.23
33 0.28
34 0.26
35 0.26
36 0.28
37 0.27
38 0.26
39 0.23
40 0.26
41 0.2
42 0.18
43 0.19
44 0.18
45 0.21
46 0.23
47 0.25
48 0.22
49 0.21
50 0.21
51 0.18
52 0.16
53 0.14
54 0.11
55 0.1
56 0.1
57 0.09
58 0.09
59 0.09
60 0.1
61 0.1
62 0.09
63 0.08
64 0.07
65 0.07
66 0.06
67 0.05
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.03
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.05
83 0.05
84 0.08
85 0.11
86 0.12
87 0.14
88 0.16
89 0.25
90 0.35
91 0.46
92 0.54
93 0.61
94 0.71
95 0.81
96 0.89
97 0.92
98 0.92
99 0.92
100 0.9
101 0.89
102 0.88
103 0.84
104 0.82
105 0.81
106 0.74
107 0.66