Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FIY3

Protein Details
Accession Q6FIY3    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
124-148MDELFKESRRNTKPKKKSHKKHKKABasic
NLS Segment(s)
PositionSequence
131-148SRRNTKPKKKSHKKHKKA
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
KEGG cgr:CAGL0M10681g  -  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MSGKGELSSRVMNMKFMKFMRPEGQDNKDEGTSKHTHLDASKWDLKSSVNSDSTNKRRVVVKRASKALKIMENVGITSVKAEDDSNKSSALHGRRIFGENKNKRVAEEEEENKTEQEPKQEKDMDELFKESRRNTKPKKKSHKKHKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.33
4 0.38
5 0.35
6 0.4
7 0.41
8 0.42
9 0.46
10 0.48
11 0.53
12 0.49
13 0.48
14 0.46
15 0.41
16 0.37
17 0.31
18 0.3
19 0.27
20 0.26
21 0.28
22 0.25
23 0.25
24 0.25
25 0.28
26 0.25
27 0.3
28 0.34
29 0.3
30 0.3
31 0.29
32 0.29
33 0.29
34 0.28
35 0.26
36 0.23
37 0.23
38 0.27
39 0.35
40 0.4
41 0.41
42 0.39
43 0.35
44 0.39
45 0.42
46 0.48
47 0.48
48 0.52
49 0.52
50 0.59
51 0.59
52 0.53
53 0.52
54 0.46
55 0.4
56 0.32
57 0.27
58 0.22
59 0.2
60 0.19
61 0.17
62 0.13
63 0.09
64 0.09
65 0.07
66 0.05
67 0.05
68 0.05
69 0.07
70 0.11
71 0.14
72 0.15
73 0.15
74 0.15
75 0.16
76 0.21
77 0.21
78 0.25
79 0.24
80 0.25
81 0.27
82 0.3
83 0.33
84 0.35
85 0.43
86 0.43
87 0.47
88 0.52
89 0.5
90 0.47
91 0.48
92 0.44
93 0.39
94 0.4
95 0.38
96 0.37
97 0.39
98 0.39
99 0.34
100 0.32
101 0.31
102 0.24
103 0.3
104 0.31
105 0.32
106 0.39
107 0.44
108 0.43
109 0.44
110 0.48
111 0.42
112 0.38
113 0.4
114 0.34
115 0.34
116 0.37
117 0.35
118 0.4
119 0.44
120 0.53
121 0.6
122 0.69
123 0.75
124 0.82
125 0.9
126 0.91
127 0.94
128 0.95