Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2HJU9

Protein Details
Accession A0A0D2HJU9   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSSNQKQSKIGKKWKRPHSNIQLVQGHydrophilic
NLS Segment(s)
PositionSequence
51-80KEKPKRDESKAAKKGIGIKAKAWGWAKKGW
Subcellular Location(s) nucl 15.5, cyto_nucl 12, mito 6, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSSNQKQSKIGKKWKRPHSNIQLVQGTVQETDIIRPEGYGDDSYRDYDKTKEKPKRDESKAAKKGIGIKAKAWGWAKKGWSRIHGDGERSTETGSLEQRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.91
3 0.88
4 0.89
5 0.89
6 0.89
7 0.83
8 0.8
9 0.72
10 0.61
11 0.54
12 0.44
13 0.34
14 0.23
15 0.18
16 0.12
17 0.09
18 0.09
19 0.11
20 0.11
21 0.09
22 0.09
23 0.1
24 0.1
25 0.11
26 0.11
27 0.1
28 0.11
29 0.12
30 0.13
31 0.14
32 0.13
33 0.13
34 0.15
35 0.22
36 0.27
37 0.36
38 0.43
39 0.49
40 0.57
41 0.66
42 0.73
43 0.72
44 0.75
45 0.74
46 0.77
47 0.78
48 0.72
49 0.63
50 0.54
51 0.56
52 0.53
53 0.51
54 0.41
55 0.35
56 0.39
57 0.38
58 0.42
59 0.39
60 0.35
61 0.31
62 0.35
63 0.39
64 0.38
65 0.45
66 0.43
67 0.45
68 0.48
69 0.49
70 0.54
71 0.52
72 0.51
73 0.47
74 0.47
75 0.44
76 0.38
77 0.34
78 0.25
79 0.23
80 0.23