Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2H271

Protein Details
Accession A0A0D2H271   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
224-254AAQLRGEEQPKRRTKRRRREVVPRPPPQTDQHydrophilic
NLS Segment(s)
PositionSequence
233-244PKRRTKRRRREV
Subcellular Location(s) nucl 17, cyto_nucl 12, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR025207  Sim4_Fta4  
Gene Ontology GO:0031511  C:Mis6-Sim4 complex  
Pfam View protein in Pfam  
PF13093  FTA4  
Amino Acid Sequences MAEPTITAIKAAFLRVEVRQLETPLEPSTHWRAHGLNPGPESREGRPLLSDKAVQDLVAKVNDKIKQHNRLVFSTQSQRHVAEQIESLLWARTSAAAEHAELDTLAIRKDVDLGDSAVISALPHDYAALHIHPDHDTARNEEGGDGREGQKDAEEQYARLRGELVTLSRQRDALKARLARYQHLQEMTEPLRDPQENVQPNLVTKHGKLAKELDRTRVILLRIAAQLRGEEQPKRRTKRRRREVVPRPPPQTDQEKLGQVLGWTRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.23
4 0.21
5 0.25
6 0.26
7 0.27
8 0.28
9 0.26
10 0.28
11 0.23
12 0.23
13 0.19
14 0.22
15 0.29
16 0.28
17 0.28
18 0.29
19 0.29
20 0.33
21 0.42
22 0.41
23 0.39
24 0.39
25 0.4
26 0.41
27 0.42
28 0.41
29 0.34
30 0.36
31 0.32
32 0.3
33 0.32
34 0.32
35 0.32
36 0.31
37 0.31
38 0.24
39 0.27
40 0.26
41 0.22
42 0.21
43 0.19
44 0.19
45 0.19
46 0.2
47 0.16
48 0.22
49 0.26
50 0.27
51 0.35
52 0.41
53 0.47
54 0.52
55 0.56
56 0.55
57 0.54
58 0.56
59 0.49
60 0.46
61 0.45
62 0.42
63 0.41
64 0.39
65 0.37
66 0.34
67 0.34
68 0.3
69 0.22
70 0.2
71 0.16
72 0.14
73 0.13
74 0.12
75 0.1
76 0.09
77 0.07
78 0.06
79 0.06
80 0.07
81 0.07
82 0.09
83 0.09
84 0.09
85 0.1
86 0.1
87 0.09
88 0.08
89 0.08
90 0.07
91 0.07
92 0.07
93 0.06
94 0.06
95 0.06
96 0.07
97 0.07
98 0.07
99 0.07
100 0.08
101 0.07
102 0.07
103 0.07
104 0.06
105 0.05
106 0.04
107 0.04
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.04
114 0.06
115 0.05
116 0.06
117 0.06
118 0.07
119 0.08
120 0.09
121 0.09
122 0.12
123 0.13
124 0.15
125 0.16
126 0.15
127 0.15
128 0.15
129 0.14
130 0.12
131 0.12
132 0.11
133 0.11
134 0.12
135 0.12
136 0.11
137 0.11
138 0.1
139 0.11
140 0.15
141 0.14
142 0.13
143 0.16
144 0.21
145 0.2
146 0.19
147 0.18
148 0.13
149 0.14
150 0.15
151 0.14
152 0.16
153 0.19
154 0.2
155 0.21
156 0.22
157 0.21
158 0.25
159 0.27
160 0.25
161 0.3
162 0.33
163 0.34
164 0.38
165 0.39
166 0.37
167 0.39
168 0.38
169 0.35
170 0.32
171 0.31
172 0.27
173 0.32
174 0.31
175 0.27
176 0.24
177 0.2
178 0.23
179 0.22
180 0.23
181 0.22
182 0.3
183 0.31
184 0.32
185 0.35
186 0.31
187 0.32
188 0.32
189 0.29
190 0.22
191 0.18
192 0.26
193 0.29
194 0.29
195 0.3
196 0.36
197 0.41
198 0.48
199 0.51
200 0.47
201 0.46
202 0.47
203 0.46
204 0.43
205 0.36
206 0.29
207 0.28
208 0.26
209 0.25
210 0.25
211 0.23
212 0.2
213 0.2
214 0.19
215 0.23
216 0.22
217 0.26
218 0.32
219 0.42
220 0.51
221 0.6
222 0.67
223 0.74
224 0.81
225 0.86
226 0.9
227 0.91
228 0.91
229 0.93
230 0.94
231 0.94
232 0.94
233 0.91
234 0.87
235 0.8
236 0.75
237 0.7
238 0.68
239 0.6
240 0.55
241 0.51
242 0.49
243 0.45
244 0.42
245 0.37
246 0.29