Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FSA8

Protein Details
Accession Q6FSA8    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-28HGNQHDDTKKKPRRNSSTEVLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5cyto_nucl 11.5, nucl 8.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036786  Ribosome_mat_SBDS_N_sf  
IPR019783  SDO1/SBDS_N  
Gene Ontology GO:0062040  C:fungal biofilm matrix  
GO:0016070  P:RNA metabolic process  
KEGG cgr:CAGL0H02101g  -  
Pfam View protein in Pfam  
PF01172  SBDS  
Amino Acid Sequences MSLNELFHGNQHDDTKKKPRRNSSTEVLQYFYKGKETDLVIYVTSQAAADDYLASPSPSKLANVVEVFKVFTNLDGKGATGTFGEASKAQLENEFGKGKKVEEVIGLILKEGVPNGKTNRVKTEGNFQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.48
3 0.54
4 0.6
5 0.66
6 0.71
7 0.75
8 0.81
9 0.81
10 0.78
11 0.78
12 0.76
13 0.69
14 0.6
15 0.5
16 0.44
17 0.39
18 0.31
19 0.24
20 0.18
21 0.17
22 0.18
23 0.19
24 0.19
25 0.19
26 0.19
27 0.15
28 0.15
29 0.15
30 0.11
31 0.1
32 0.07
33 0.05
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.05
40 0.05
41 0.06
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.08
48 0.08
49 0.11
50 0.12
51 0.13
52 0.12
53 0.12
54 0.12
55 0.11
56 0.11
57 0.08
58 0.08
59 0.09
60 0.09
61 0.1
62 0.09
63 0.09
64 0.08
65 0.09
66 0.08
67 0.06
68 0.06
69 0.06
70 0.06
71 0.07
72 0.06
73 0.07
74 0.09
75 0.1
76 0.1
77 0.1
78 0.13
79 0.13
80 0.17
81 0.2
82 0.18
83 0.21
84 0.22
85 0.22
86 0.23
87 0.22
88 0.2
89 0.17
90 0.19
91 0.17
92 0.19
93 0.18
94 0.14
95 0.13
96 0.12
97 0.11
98 0.1
99 0.11
100 0.1
101 0.15
102 0.19
103 0.29
104 0.35
105 0.38
106 0.45
107 0.47
108 0.5
109 0.48