Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2EX54

Protein Details
Accession A0A0D2EX54   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
89-108ESVSKPKATLQNRNRKNPGDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, extr 9, cyto_mito 8.833, cyto 4, cyto_nucl 2.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR013241  RNase_P_Pop3  
Gene Ontology GO:0006364  P:rRNA processing  
GO:0008033  P:tRNA processing  
Amino Acid Sequences MTSSIPLLLASSAPATTRARLVEWSSQAEEQVARALHQPRVGVLGIGEGAPGAETLLRFVQDNVDAVDVPWLDHTPKPTYHSVNIQTVESVSKPKATLQNRNRKNPGDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.14
4 0.17
5 0.17
6 0.17
7 0.2
8 0.23
9 0.26
10 0.27
11 0.3
12 0.29
13 0.28
14 0.27
15 0.25
16 0.21
17 0.15
18 0.16
19 0.12
20 0.1
21 0.15
22 0.18
23 0.19
24 0.2
25 0.2
26 0.17
27 0.19
28 0.18
29 0.13
30 0.1
31 0.09
32 0.07
33 0.07
34 0.06
35 0.03
36 0.03
37 0.03
38 0.03
39 0.02
40 0.03
41 0.03
42 0.04
43 0.04
44 0.05
45 0.05
46 0.05
47 0.07
48 0.07
49 0.08
50 0.07
51 0.08
52 0.07
53 0.07
54 0.09
55 0.08
56 0.07
57 0.07
58 0.08
59 0.09
60 0.1
61 0.13
62 0.15
63 0.17
64 0.22
65 0.26
66 0.29
67 0.31
68 0.38
69 0.39
70 0.41
71 0.41
72 0.37
73 0.32
74 0.29
75 0.27
76 0.2
77 0.19
78 0.15
79 0.16
80 0.16
81 0.21
82 0.3
83 0.36
84 0.46
85 0.53
86 0.63
87 0.7
88 0.8
89 0.82