Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2G1B8

Protein Details
Accession A0A0D2G1B8    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
46-74APKPVAQTKKTLKHVPKRKRDAVQDDSESHydrophilic
NLS Segment(s)
PositionSequence
53-65TKKTLKHVPKRKR
Subcellular Location(s) mito 19, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR032054  Cdt1_C  
IPR038090  Cdt1_C_WH_dom_sf  
Gene Ontology GO:0007049  P:cell cycle  
Pfam View protein in Pfam  
PF16679  CDT1_C  
Amino Acid Sequences MALSVRGTSHRISKRQTPIDTRAKVSKASKSAKLSVALRSKLEEVAPKPVAQTKKTLKHVPKRKRDAVQDDSESEAGSVYITQINSKKPKLQLPTPPSSKSKGEKEVVDMDFSPTLTFRQLSLDTDNAEPVPQALPPVLQDFVSLHAALLKAFALHLVHNGQSTPADLGSLMSSVTRLWKKHTVTREDIQRMLAIYELDVSTHFSGRLLKHQEGPFRLTMTGADFARYNIEYVGAGSKRSFIPRWDECNLQKLYEAEIEACWVSQRNNSSCWVHGPIQNFPRLNFDVGVETQVRIAKAETARREILGLASEAQTRAGAQFSLYTSNASERNEVNNPQIVKDRTLSLLDRVRAKALVNSAATPRSAEATLRRYAVGRISEVVEILRMKQQRKLSANFVSCVHSSPSKVRGKVSFTMKQLINDVKGSLTVPIGDAELRMCIHILQDEIPGMWVSIYTVGTVESVILNGPGLSGVEVKRILDEKEAMC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.7
3 0.75
4 0.74
5 0.75
6 0.78
7 0.76
8 0.72
9 0.69
10 0.63
11 0.62
12 0.59
13 0.58
14 0.57
15 0.59
16 0.61
17 0.6
18 0.64
19 0.61
20 0.61
21 0.55
22 0.55
23 0.57
24 0.52
25 0.46
26 0.43
27 0.41
28 0.37
29 0.37
30 0.35
31 0.29
32 0.35
33 0.35
34 0.33
35 0.33
36 0.38
37 0.41
38 0.36
39 0.43
40 0.44
41 0.52
42 0.59
43 0.67
44 0.7
45 0.75
46 0.84
47 0.85
48 0.86
49 0.87
50 0.88
51 0.87
52 0.87
53 0.85
54 0.83
55 0.8
56 0.74
57 0.65
58 0.59
59 0.51
60 0.41
61 0.31
62 0.23
63 0.14
64 0.1
65 0.08
66 0.06
67 0.09
68 0.09
69 0.13
70 0.17
71 0.25
72 0.32
73 0.35
74 0.41
75 0.43
76 0.51
77 0.54
78 0.59
79 0.61
80 0.63
81 0.69
82 0.68
83 0.68
84 0.64
85 0.61
86 0.6
87 0.56
88 0.56
89 0.54
90 0.53
91 0.49
92 0.5
93 0.54
94 0.48
95 0.43
96 0.36
97 0.3
98 0.26
99 0.24
100 0.2
101 0.12
102 0.12
103 0.12
104 0.12
105 0.1
106 0.13
107 0.15
108 0.17
109 0.2
110 0.2
111 0.2
112 0.2
113 0.21
114 0.16
115 0.15
116 0.13
117 0.1
118 0.09
119 0.07
120 0.07
121 0.07
122 0.07
123 0.08
124 0.1
125 0.1
126 0.09
127 0.1
128 0.09
129 0.12
130 0.13
131 0.12
132 0.09
133 0.11
134 0.11
135 0.1
136 0.1
137 0.07
138 0.05
139 0.05
140 0.06
141 0.06
142 0.06
143 0.08
144 0.09
145 0.1
146 0.1
147 0.1
148 0.1
149 0.09
150 0.1
151 0.08
152 0.07
153 0.06
154 0.06
155 0.06
156 0.06
157 0.06
158 0.05
159 0.04
160 0.05
161 0.05
162 0.11
163 0.15
164 0.15
165 0.2
166 0.28
167 0.31
168 0.38
169 0.45
170 0.46
171 0.48
172 0.54
173 0.58
174 0.53
175 0.51
176 0.45
177 0.38
178 0.31
179 0.25
180 0.2
181 0.11
182 0.07
183 0.07
184 0.07
185 0.06
186 0.06
187 0.08
188 0.08
189 0.08
190 0.08
191 0.08
192 0.12
193 0.13
194 0.2
195 0.23
196 0.24
197 0.3
198 0.33
199 0.38
200 0.36
201 0.38
202 0.32
203 0.28
204 0.26
205 0.2
206 0.17
207 0.14
208 0.15
209 0.12
210 0.11
211 0.1
212 0.1
213 0.12
214 0.12
215 0.1
216 0.07
217 0.07
218 0.06
219 0.07
220 0.11
221 0.09
222 0.09
223 0.09
224 0.11
225 0.11
226 0.14
227 0.15
228 0.13
229 0.2
230 0.24
231 0.3
232 0.31
233 0.34
234 0.33
235 0.39
236 0.38
237 0.31
238 0.27
239 0.22
240 0.21
241 0.18
242 0.17
243 0.1
244 0.09
245 0.1
246 0.08
247 0.08
248 0.06
249 0.06
250 0.06
251 0.09
252 0.14
253 0.15
254 0.17
255 0.2
256 0.21
257 0.21
258 0.23
259 0.25
260 0.23
261 0.24
262 0.24
263 0.27
264 0.29
265 0.34
266 0.31
267 0.27
268 0.31
269 0.29
270 0.28
271 0.22
272 0.19
273 0.17
274 0.16
275 0.18
276 0.13
277 0.12
278 0.12
279 0.13
280 0.12
281 0.1
282 0.1
283 0.13
284 0.16
285 0.22
286 0.23
287 0.26
288 0.27
289 0.27
290 0.27
291 0.22
292 0.19
293 0.14
294 0.12
295 0.09
296 0.09
297 0.1
298 0.09
299 0.09
300 0.08
301 0.08
302 0.08
303 0.07
304 0.06
305 0.05
306 0.07
307 0.08
308 0.11
309 0.11
310 0.11
311 0.11
312 0.14
313 0.16
314 0.16
315 0.18
316 0.16
317 0.21
318 0.24
319 0.25
320 0.25
321 0.27
322 0.26
323 0.25
324 0.31
325 0.28
326 0.26
327 0.26
328 0.25
329 0.22
330 0.25
331 0.24
332 0.23
333 0.27
334 0.28
335 0.31
336 0.3
337 0.3
338 0.28
339 0.28
340 0.25
341 0.22
342 0.24
343 0.2
344 0.21
345 0.22
346 0.22
347 0.21
348 0.19
349 0.16
350 0.14
351 0.13
352 0.14
353 0.18
354 0.21
355 0.24
356 0.24
357 0.24
358 0.23
359 0.24
360 0.27
361 0.23
362 0.2
363 0.19
364 0.2
365 0.19
366 0.19
367 0.17
368 0.14
369 0.12
370 0.13
371 0.17
372 0.2
373 0.22
374 0.28
375 0.34
376 0.41
377 0.47
378 0.5
379 0.51
380 0.55
381 0.57
382 0.52
383 0.48
384 0.43
385 0.37
386 0.34
387 0.3
388 0.24
389 0.24
390 0.27
391 0.34
392 0.38
393 0.4
394 0.43
395 0.45
396 0.48
397 0.53
398 0.57
399 0.54
400 0.5
401 0.55
402 0.52
403 0.48
404 0.48
405 0.45
406 0.39
407 0.33
408 0.31
409 0.23
410 0.22
411 0.21
412 0.17
413 0.13
414 0.1
415 0.09
416 0.09
417 0.1
418 0.09
419 0.09
420 0.08
421 0.1
422 0.1
423 0.09
424 0.09
425 0.08
426 0.1
427 0.11
428 0.12
429 0.11
430 0.13
431 0.13
432 0.13
433 0.14
434 0.12
435 0.11
436 0.09
437 0.08
438 0.07
439 0.09
440 0.09
441 0.08
442 0.08
443 0.08
444 0.09
445 0.09
446 0.09
447 0.06
448 0.06
449 0.06
450 0.06
451 0.06
452 0.06
453 0.06
454 0.05
455 0.06
456 0.06
457 0.1
458 0.1
459 0.15
460 0.16
461 0.16
462 0.2
463 0.22
464 0.23
465 0.24