Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B4UN58

Protein Details
Accession B4UN58    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
16-36NKNVEKQRKFGKKKQDKQKTEBasic
NLS Segment(s)
PositionSequence
21-30KQRKFGKKKQ
Subcellular Location(s) nucl 6.5, E.R. 6, cyto_nucl 4.5, mito 4, plas 4, golg 3, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0009306  P:protein secretion  
KEGG cgr:CAGL0M05593g  -  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MAVQTPKQRLANEKFNKNVEKQRKFGKKKQDKQKTELPISKSWVYFILFLLIGGGVLELFSLLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.63
3 0.65
4 0.62
5 0.64
6 0.64
7 0.61
8 0.58
9 0.63
10 0.68
11 0.71
12 0.72
13 0.73
14 0.74
15 0.77
16 0.84
17 0.85
18 0.79
19 0.77
20 0.78
21 0.74
22 0.71
23 0.66
24 0.6
25 0.52
26 0.52
27 0.49
28 0.41
29 0.34
30 0.28
31 0.24
32 0.21
33 0.18
34 0.15
35 0.12
36 0.11
37 0.11
38 0.08
39 0.07
40 0.06
41 0.06
42 0.03
43 0.03
44 0.03