Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6FRQ2

Protein Details
Accession Q6FRQ2    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-23EQISHKKSLRVGKNKRSLLKEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13.833, cyto 3, cyto_pero 2.499
Family & Domain DBs
Gene Ontology GO:0005829  C:cytosol  
GO:0000938  C:GARP complex  
GO:0007118  P:budding cell apical bud growth  
GO:0090156  P:intracellular sphingolipid homeostasis  
GO:0016239  P:positive regulation of macroautophagy  
GO:0006623  P:protein targeting to vacuole  
GO:0042147  P:retrograde transport, endosome to Golgi  
GO:0016050  P:vesicle organization  
KEGG cgr:CAGL0H06809g  -  
Pfam View protein in Pfam  
PF08700  Vps51  
Amino Acid Sequences MAEQISHKKSLRVGKNKRSLLKEYYHLEDGATKTDEPVTGEVHEQDNNTLQTDTGNEEVVKEVLEDSDSQPNVDRPINEQTLKELVATHNTLLGKETATNSSIKNTIYENYYDLVKVNDKLKELSGDKLQQSMDSLKKAVEESLRSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.77
3 0.82
4 0.83
5 0.8
6 0.75
7 0.7
8 0.65
9 0.61
10 0.56
11 0.53
12 0.47
13 0.41
14 0.35
15 0.33
16 0.29
17 0.25
18 0.23
19 0.18
20 0.16
21 0.17
22 0.18
23 0.15
24 0.15
25 0.13
26 0.12
27 0.13
28 0.14
29 0.15
30 0.15
31 0.14
32 0.13
33 0.15
34 0.15
35 0.15
36 0.14
37 0.12
38 0.11
39 0.12
40 0.12
41 0.1
42 0.1
43 0.08
44 0.09
45 0.09
46 0.09
47 0.08
48 0.06
49 0.05
50 0.05
51 0.05
52 0.06
53 0.07
54 0.12
55 0.12
56 0.12
57 0.13
58 0.13
59 0.15
60 0.16
61 0.14
62 0.13
63 0.18
64 0.21
65 0.21
66 0.21
67 0.2
68 0.2
69 0.2
70 0.17
71 0.13
72 0.1
73 0.12
74 0.13
75 0.11
76 0.13
77 0.13
78 0.13
79 0.13
80 0.13
81 0.1
82 0.1
83 0.12
84 0.1
85 0.11
86 0.12
87 0.12
88 0.14
89 0.15
90 0.14
91 0.14
92 0.14
93 0.15
94 0.16
95 0.16
96 0.15
97 0.14
98 0.15
99 0.14
100 0.13
101 0.14
102 0.14
103 0.16
104 0.19
105 0.21
106 0.22
107 0.24
108 0.25
109 0.29
110 0.28
111 0.3
112 0.32
113 0.35
114 0.34
115 0.36
116 0.34
117 0.28
118 0.29
119 0.32
120 0.29
121 0.27
122 0.27
123 0.24
124 0.26
125 0.26
126 0.27
127 0.26