Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2G8W8

Protein Details
Accession A0A0D2G8W8    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
250-270SETESGKKEKGGKKRAEKSRRBasic
NLS Segment(s)
PositionSequence
255-270GKKEKGGKKRAEKSRR
Subcellular Location(s) nucl 15, cyto_nucl 12, cyto 7, mito 5
Family & Domain DBs
Amino Acid Sequences MPFRFSELAKRGKSVSNSGAFEEEEEATARPMTTARSSYAYSDYVSEDLNDYTSEYAYDVRDSKLKSNSSGLPQSAVSLRVGPRRPDRTDTPAPASIYYDNGTGVLHANFVRDQGLPPHVRTTAQLAEFIRMREDSSNGLEDGGAAPPASFFSTSSSSCYSSHSSSSSSNSNPPSPSQSTGPMYHHGPASRSHERIRVTAAAAAAAGILIRHHHVARPIVRVRVLPGATRTYRYQGFWLRRGTMRKTNNSETESGKKEKGGKKRAEKSRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.45
4 0.45
5 0.44
6 0.43
7 0.36
8 0.33
9 0.29
10 0.21
11 0.15
12 0.15
13 0.13
14 0.12
15 0.13
16 0.12
17 0.1
18 0.1
19 0.12
20 0.15
21 0.17
22 0.18
23 0.21
24 0.22
25 0.24
26 0.27
27 0.24
28 0.21
29 0.2
30 0.2
31 0.17
32 0.16
33 0.14
34 0.12
35 0.12
36 0.12
37 0.1
38 0.09
39 0.09
40 0.09
41 0.09
42 0.08
43 0.09
44 0.09
45 0.12
46 0.13
47 0.14
48 0.18
49 0.2
50 0.25
51 0.3
52 0.31
53 0.31
54 0.34
55 0.37
56 0.38
57 0.41
58 0.35
59 0.3
60 0.28
61 0.27
62 0.24
63 0.21
64 0.15
65 0.14
66 0.17
67 0.22
68 0.26
69 0.3
70 0.37
71 0.43
72 0.47
73 0.49
74 0.51
75 0.53
76 0.57
77 0.55
78 0.52
79 0.49
80 0.46
81 0.4
82 0.37
83 0.29
84 0.23
85 0.2
86 0.15
87 0.11
88 0.1
89 0.09
90 0.08
91 0.08
92 0.07
93 0.07
94 0.07
95 0.08
96 0.08
97 0.08
98 0.09
99 0.08
100 0.09
101 0.1
102 0.16
103 0.16
104 0.17
105 0.19
106 0.18
107 0.18
108 0.18
109 0.2
110 0.18
111 0.17
112 0.19
113 0.17
114 0.19
115 0.2
116 0.19
117 0.16
118 0.12
119 0.12
120 0.1
121 0.11
122 0.1
123 0.11
124 0.11
125 0.1
126 0.1
127 0.09
128 0.08
129 0.08
130 0.06
131 0.05
132 0.04
133 0.04
134 0.04
135 0.05
136 0.05
137 0.05
138 0.05
139 0.08
140 0.11
141 0.12
142 0.14
143 0.16
144 0.17
145 0.17
146 0.2
147 0.2
148 0.19
149 0.2
150 0.19
151 0.19
152 0.19
153 0.21
154 0.22
155 0.2
156 0.23
157 0.25
158 0.26
159 0.25
160 0.25
161 0.29
162 0.28
163 0.29
164 0.26
165 0.28
166 0.29
167 0.3
168 0.31
169 0.28
170 0.27
171 0.26
172 0.27
173 0.23
174 0.21
175 0.22
176 0.28
177 0.31
178 0.33
179 0.34
180 0.37
181 0.38
182 0.38
183 0.37
184 0.31
185 0.26
186 0.25
187 0.23
188 0.17
189 0.15
190 0.13
191 0.09
192 0.06
193 0.05
194 0.03
195 0.03
196 0.04
197 0.06
198 0.08
199 0.09
200 0.11
201 0.15
202 0.23
203 0.26
204 0.34
205 0.37
206 0.38
207 0.39
208 0.38
209 0.37
210 0.37
211 0.35
212 0.29
213 0.29
214 0.32
215 0.32
216 0.35
217 0.35
218 0.33
219 0.35
220 0.34
221 0.37
222 0.4
223 0.45
224 0.48
225 0.51
226 0.5
227 0.54
228 0.58
229 0.59
230 0.59
231 0.61
232 0.65
233 0.67
234 0.71
235 0.72
236 0.69
237 0.65
238 0.61
239 0.6
240 0.57
241 0.54
242 0.47
243 0.45
244 0.5
245 0.55
246 0.59
247 0.61
248 0.66
249 0.72
250 0.8