Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6FL01

Protein Details
Accession Q6FL01    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
147-173IPNEDDTSRRKKKRNNKTNISNNDNNDHydrophilic
NLS Segment(s)
PositionSequence
155-160RRKKKR
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR040107  Snu23  
IPR036236  Znf_C2H2_sf  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0046540  C:U4/U6 x U5 tri-snRNP complex  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
GO:0000398  P:mRNA splicing, via spliceosome  
KEGG cgr:CAGL0L07260g  -  
Pfam View protein in Pfam  
PF12874  zf-met  
Amino Acid Sequences MSNFGRRTWDRDEYDTVPELSHLQSLKDTLSDVQLEQLKKKYTNYDMLLKRSMSGLNKRVLATNVSSFKKGQQYGFYCELCNITLKDSLQYVDHLNHKSHELKFEALFEEPLITETRDNDDIPIEEFNLLYKEKIRSFVKANRVVAIPNEDDTSRRKKKRNNKTNISNNDNNDDDTIKKVMGFSNFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.47
3 0.4
4 0.31
5 0.28
6 0.24
7 0.19
8 0.19
9 0.15
10 0.14
11 0.15
12 0.15
13 0.15
14 0.14
15 0.14
16 0.11
17 0.14
18 0.14
19 0.13
20 0.17
21 0.21
22 0.22
23 0.24
24 0.29
25 0.3
26 0.31
27 0.34
28 0.37
29 0.37
30 0.43
31 0.44
32 0.48
33 0.48
34 0.5
35 0.51
36 0.44
37 0.39
38 0.32
39 0.32
40 0.28
41 0.31
42 0.32
43 0.32
44 0.34
45 0.34
46 0.35
47 0.32
48 0.29
49 0.24
50 0.24
51 0.27
52 0.26
53 0.27
54 0.25
55 0.28
56 0.33
57 0.32
58 0.28
59 0.3
60 0.32
61 0.36
62 0.41
63 0.37
64 0.31
65 0.29
66 0.28
67 0.2
68 0.19
69 0.13
70 0.1
71 0.12
72 0.12
73 0.12
74 0.11
75 0.12
76 0.1
77 0.11
78 0.11
79 0.11
80 0.16
81 0.17
82 0.17
83 0.17
84 0.19
85 0.22
86 0.22
87 0.22
88 0.2
89 0.2
90 0.2
91 0.2
92 0.18
93 0.15
94 0.14
95 0.1
96 0.09
97 0.07
98 0.08
99 0.08
100 0.07
101 0.07
102 0.08
103 0.12
104 0.13
105 0.13
106 0.12
107 0.12
108 0.12
109 0.13
110 0.13
111 0.1
112 0.08
113 0.08
114 0.08
115 0.09
116 0.09
117 0.08
118 0.11
119 0.15
120 0.16
121 0.23
122 0.24
123 0.26
124 0.33
125 0.4
126 0.46
127 0.49
128 0.49
129 0.45
130 0.44
131 0.41
132 0.36
133 0.34
134 0.25
135 0.19
136 0.2
137 0.17
138 0.18
139 0.23
140 0.31
141 0.36
142 0.44
143 0.51
144 0.59
145 0.7
146 0.8
147 0.86
148 0.86
149 0.87
150 0.89
151 0.92
152 0.91
153 0.89
154 0.85
155 0.78
156 0.72
157 0.63
158 0.53
159 0.45
160 0.37
161 0.29
162 0.26
163 0.24
164 0.18
165 0.17
166 0.17
167 0.19