Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6FY89

Protein Details
Accession Q6FY89    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
34-64DEEPKAKKEAAKPKPKPKAGGKKNAKGEEKKBasic
NLS Segment(s)
PositionSequence
38-64KAKKEAAKPKPKPKAGGKKNAKGEEKK
209-236KAERQARLARVKGGTATGGAGKKKAKAK
Subcellular Location(s) cyto 11.5, cyto_nucl 11.5, nucl 10.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR023194  eIF3-like_dom_sf  
IPR013906  eIF3j  
Gene Ontology GO:0016282  C:eukaryotic 43S preinitiation complex  
GO:0033290  C:eukaryotic 48S preinitiation complex  
GO:0005852  C:eukaryotic translation initiation factor 3 complex  
GO:0003743  F:translation initiation factor activity  
GO:0001732  P:formation of cytoplasmic translation initiation complex  
KEGG cgr:CAGL0A04125g  -  
Pfam View protein in Pfam  
PF08597  eIF3_subunit  
Amino Acid Sequences MSWDDAGNDDAVLMDSWDAEVDFAGDEPILDSWDEEPKAKKEAAKPKPKPKAGGKKNAKGEEKKEQVLAIDELDPQTRKELMKKAELESDLNNAADLLGDLEMAEEHPRARAMQKEQELAAQAALLRPAMTKDTPIEDHPLFKAETKKEYQDLRKALATAIVTMHEKSSLNYSSSLAIDLIRDVSKPMSIENIRQTVATLNILIKDKEKAERQARLARVKGGTATGGAGKKKAKAKTNLGGAFKKDQDFDVDDINYDDFGADDFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.06
4 0.06
5 0.06
6 0.05
7 0.05
8 0.05
9 0.05
10 0.05
11 0.05
12 0.05
13 0.05
14 0.06
15 0.06
16 0.06
17 0.06
18 0.07
19 0.08
20 0.15
21 0.16
22 0.18
23 0.22
24 0.24
25 0.28
26 0.29
27 0.33
28 0.37
29 0.47
30 0.55
31 0.61
32 0.69
33 0.76
34 0.84
35 0.84
36 0.83
37 0.83
38 0.83
39 0.82
40 0.83
41 0.82
42 0.81
43 0.85
44 0.85
45 0.82
46 0.78
47 0.74
48 0.73
49 0.69
50 0.62
51 0.54
52 0.46
53 0.39
54 0.35
55 0.29
56 0.2
57 0.15
58 0.14
59 0.13
60 0.15
61 0.15
62 0.12
63 0.14
64 0.15
65 0.15
66 0.2
67 0.27
68 0.29
69 0.36
70 0.38
71 0.38
72 0.4
73 0.4
74 0.36
75 0.3
76 0.29
77 0.22
78 0.19
79 0.17
80 0.12
81 0.1
82 0.08
83 0.07
84 0.04
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.04
91 0.05
92 0.05
93 0.05
94 0.05
95 0.06
96 0.07
97 0.09
98 0.14
99 0.18
100 0.25
101 0.27
102 0.28
103 0.28
104 0.28
105 0.28
106 0.23
107 0.18
108 0.11
109 0.08
110 0.07
111 0.07
112 0.05
113 0.04
114 0.04
115 0.05
116 0.07
117 0.07
118 0.07
119 0.08
120 0.1
121 0.12
122 0.13
123 0.17
124 0.15
125 0.17
126 0.16
127 0.17
128 0.15
129 0.16
130 0.22
131 0.19
132 0.23
133 0.24
134 0.26
135 0.29
136 0.35
137 0.37
138 0.39
139 0.39
140 0.37
141 0.36
142 0.34
143 0.3
144 0.26
145 0.21
146 0.14
147 0.12
148 0.11
149 0.1
150 0.1
151 0.1
152 0.09
153 0.09
154 0.09
155 0.13
156 0.14
157 0.14
158 0.15
159 0.15
160 0.15
161 0.15
162 0.15
163 0.11
164 0.09
165 0.08
166 0.08
167 0.09
168 0.07
169 0.07
170 0.08
171 0.08
172 0.09
173 0.09
174 0.09
175 0.15
176 0.16
177 0.2
178 0.25
179 0.27
180 0.26
181 0.26
182 0.26
183 0.2
184 0.21
185 0.17
186 0.13
187 0.11
188 0.14
189 0.15
190 0.16
191 0.15
192 0.16
193 0.18
194 0.23
195 0.28
196 0.34
197 0.4
198 0.47
199 0.52
200 0.57
201 0.62
202 0.63
203 0.6
204 0.56
205 0.5
206 0.44
207 0.39
208 0.32
209 0.25
210 0.18
211 0.17
212 0.16
213 0.19
214 0.19
215 0.22
216 0.23
217 0.29
218 0.36
219 0.42
220 0.46
221 0.51
222 0.59
223 0.63
224 0.71
225 0.71
226 0.71
227 0.68
228 0.63
229 0.61
230 0.56
231 0.5
232 0.41
233 0.35
234 0.34
235 0.33
236 0.31
237 0.3
238 0.26
239 0.24
240 0.24
241 0.24
242 0.19
243 0.15
244 0.13
245 0.07