Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2G6S5

Protein Details
Accession A0A0D2G6S5    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
46-66ARTRGQRKPDREQRRQGPRRSBasic
NLS Segment(s)
PositionSequence
52-64RKPDREQRRQGPR
Subcellular Location(s) mito 8, extr 7, cyto_nucl 7, nucl 5.5, cyto 5.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYISLDKRDFSSSNGGITLSTTGIISICIIVVLVITAIGSLCLADARTRGQRKPDREQRRQGPRRSAQPSDRNSQSLANSPVKSPPRAHVLDKGYAPLNSEPPPAYQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.2
4 0.2
5 0.18
6 0.09
7 0.09
8 0.07
9 0.07
10 0.06
11 0.07
12 0.06
13 0.05
14 0.04
15 0.04
16 0.04
17 0.03
18 0.03
19 0.03
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.03
30 0.03
31 0.04
32 0.05
33 0.08
34 0.15
35 0.19
36 0.21
37 0.31
38 0.37
39 0.44
40 0.53
41 0.61
42 0.64
43 0.69
44 0.76
45 0.76
46 0.81
47 0.83
48 0.79
49 0.79
50 0.74
51 0.75
52 0.72
53 0.69
54 0.66
55 0.67
56 0.64
57 0.61
58 0.58
59 0.5
60 0.45
61 0.42
62 0.34
63 0.31
64 0.33
65 0.32
66 0.3
67 0.3
68 0.36
69 0.37
70 0.39
71 0.36
72 0.34
73 0.36
74 0.39
75 0.41
76 0.42
77 0.43
78 0.44
79 0.43
80 0.41
81 0.36
82 0.32
83 0.33
84 0.27
85 0.27
86 0.24
87 0.27
88 0.25