Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FN84

Protein Details
Accession Q6FN84    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
61-91GPQVQPQMQTPKKKKKKKNKIHCSYCNEVGHHydrophilic
NLS Segment(s)
PositionSequence
71-80PKKKKKKKNK
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG cgr:CAGL0K01947g  -  
Pfam View protein in Pfam  
PF16588  zf-C2H2_10  
Amino Acid Sequences MHCIKKRDAQPNRHCYANDMGKNELEEDVRKLSEAMDQIAKLVIATGVVKKPQDGSQEPQGPQVQPQMQTPKKKKKKKNKIHCSYCNEVGHTRARCPKKLGLIDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.58
3 0.57
4 0.56
5 0.5
6 0.43
7 0.42
8 0.38
9 0.39
10 0.36
11 0.28
12 0.19
13 0.16
14 0.16
15 0.16
16 0.15
17 0.15
18 0.14
19 0.13
20 0.14
21 0.14
22 0.13
23 0.13
24 0.12
25 0.12
26 0.12
27 0.12
28 0.08
29 0.07
30 0.05
31 0.04
32 0.04
33 0.06
34 0.07
35 0.09
36 0.09
37 0.09
38 0.11
39 0.13
40 0.18
41 0.19
42 0.22
43 0.29
44 0.36
45 0.36
46 0.38
47 0.37
48 0.32
49 0.3
50 0.32
51 0.26
52 0.22
53 0.25
54 0.31
55 0.35
56 0.45
57 0.54
58 0.59
59 0.67
60 0.76
61 0.83
62 0.85
63 0.9
64 0.92
65 0.94
66 0.94
67 0.94
68 0.95
69 0.94
70 0.91
71 0.86
72 0.83
73 0.75
74 0.67
75 0.57
76 0.51
77 0.49
78 0.44
79 0.43
80 0.45
81 0.48
82 0.5
83 0.54
84 0.57
85 0.58