Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6CNX3

Protein Details
Accession Q6CNX3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
238-257LLYRIVSKGQPTKNKNKIKRHydrophilic
NLS Segment(s)
PositionSequence
252-257KNKIKR
Subcellular Location(s) extr 9, mito 5, plas 5, golg 4, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG kla:KLLA0_E09241g  -  
Amino Acid Sequences MVISLIYVLLLICSVVSETLKLPINPNRLEFDLWPYKKWEVDGSSDASSYQTCFEMNTNIKAKDLQFLIEIEEFTKWKVNVDRFGPTTSSKGKQVVNMDIYDEDQNLVQSRHGLENGETVLYVSVYEHQNFQICLINFSLDSSWNAIDSVKQVAISITSNDLIQKQKWDLITDDDLNLLSQGRDDLFSLVSADSGQELHALDVDHRNLNESTFSYLLAKVTILFCIIGVCHLLVFPILLYRIVSKGQPTKNKNKIKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.06
4 0.07
5 0.08
6 0.13
7 0.17
8 0.18
9 0.24
10 0.3
11 0.37
12 0.39
13 0.41
14 0.4
15 0.39
16 0.4
17 0.36
18 0.37
19 0.4
20 0.39
21 0.38
22 0.38
23 0.38
24 0.36
25 0.37
26 0.34
27 0.27
28 0.31
29 0.32
30 0.32
31 0.3
32 0.29
33 0.27
34 0.22
35 0.2
36 0.15
37 0.13
38 0.09
39 0.08
40 0.09
41 0.11
42 0.17
43 0.2
44 0.26
45 0.29
46 0.29
47 0.3
48 0.32
49 0.31
50 0.28
51 0.26
52 0.2
53 0.16
54 0.16
55 0.19
56 0.17
57 0.16
58 0.12
59 0.13
60 0.12
61 0.11
62 0.15
63 0.12
64 0.16
65 0.22
66 0.25
67 0.29
68 0.31
69 0.35
70 0.33
71 0.34
72 0.33
73 0.28
74 0.28
75 0.28
76 0.28
77 0.25
78 0.27
79 0.27
80 0.29
81 0.31
82 0.32
83 0.3
84 0.27
85 0.26
86 0.22
87 0.22
88 0.18
89 0.15
90 0.1
91 0.08
92 0.08
93 0.08
94 0.08
95 0.07
96 0.08
97 0.09
98 0.1
99 0.1
100 0.1
101 0.09
102 0.11
103 0.11
104 0.1
105 0.08
106 0.07
107 0.06
108 0.05
109 0.05
110 0.04
111 0.06
112 0.08
113 0.08
114 0.09
115 0.1
116 0.11
117 0.11
118 0.12
119 0.14
120 0.13
121 0.13
122 0.13
123 0.13
124 0.11
125 0.12
126 0.11
127 0.07
128 0.08
129 0.08
130 0.07
131 0.07
132 0.07
133 0.07
134 0.07
135 0.07
136 0.09
137 0.07
138 0.07
139 0.07
140 0.07
141 0.08
142 0.08
143 0.08
144 0.07
145 0.08
146 0.08
147 0.08
148 0.11
149 0.12
150 0.13
151 0.15
152 0.15
153 0.18
154 0.19
155 0.2
156 0.19
157 0.21
158 0.24
159 0.21
160 0.2
161 0.18
162 0.17
163 0.15
164 0.14
165 0.1
166 0.06
167 0.05
168 0.06
169 0.06
170 0.06
171 0.07
172 0.08
173 0.07
174 0.08
175 0.09
176 0.08
177 0.07
178 0.07
179 0.06
180 0.06
181 0.06
182 0.05
183 0.06
184 0.06
185 0.06
186 0.07
187 0.08
188 0.09
189 0.13
190 0.15
191 0.17
192 0.16
193 0.2
194 0.19
195 0.19
196 0.19
197 0.16
198 0.18
199 0.16
200 0.17
201 0.15
202 0.16
203 0.15
204 0.14
205 0.13
206 0.11
207 0.11
208 0.1
209 0.09
210 0.09
211 0.08
212 0.08
213 0.08
214 0.07
215 0.07
216 0.07
217 0.06
218 0.06
219 0.06
220 0.06
221 0.06
222 0.05
223 0.07
224 0.07
225 0.08
226 0.09
227 0.11
228 0.13
229 0.14
230 0.16
231 0.21
232 0.29
233 0.38
234 0.47
235 0.54
236 0.63
237 0.72