Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2G7Y9

Protein Details
Accession A0A0D2G7Y9   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-35DSNSTGSRQQKKGKIHPNKKLSEKVHHydrophilic
NLS Segment(s)
PositionSequence
22-23GK
Subcellular Location(s) cyto 12.5cyto_nucl 12.5, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016305  Mannose-6-P_Isomerase  
IPR046457  PMI_typeI_cat  
IPR014710  RmlC-like_jellyroll  
IPR011051  RmlC_Cupin_sf  
Gene Ontology GO:0004476  F:mannose-6-phosphate isomerase activity  
GO:0008270  F:zinc ion binding  
GO:0009298  P:GDP-mannose biosynthetic process  
Pfam View protein in Pfam  
PF20511  PMI_typeI_cat  
Amino Acid Sequences MTVSAVAEMDSNSTGSRQQKKGKIHPNKKLSEKVHKDNPDQFPDPNHKPEIAVPPSRFEAFIGFKPLVDIQELIKLELLKPFLPATTEGLTLSDDETLRTFPIPLYASDVTVHEASHENPPDYNEEKSGIENELDFTNQAIHISVKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.22
3 0.31
4 0.37
5 0.45
6 0.53
7 0.62
8 0.71
9 0.77
10 0.8
11 0.82
12 0.85
13 0.85
14 0.85
15 0.83
16 0.83
17 0.79
18 0.79
19 0.77
20 0.75
21 0.75
22 0.73
23 0.72
24 0.71
25 0.7
26 0.66
27 0.6
28 0.52
29 0.48
30 0.5
31 0.49
32 0.44
33 0.4
34 0.32
35 0.31
36 0.34
37 0.37
38 0.34
39 0.35
40 0.32
41 0.32
42 0.34
43 0.34
44 0.3
45 0.21
46 0.2
47 0.17
48 0.17
49 0.19
50 0.17
51 0.16
52 0.17
53 0.17
54 0.14
55 0.11
56 0.11
57 0.07
58 0.11
59 0.12
60 0.11
61 0.11
62 0.11
63 0.11
64 0.12
65 0.13
66 0.09
67 0.1
68 0.1
69 0.09
70 0.1
71 0.1
72 0.12
73 0.12
74 0.12
75 0.11
76 0.11
77 0.11
78 0.11
79 0.1
80 0.08
81 0.07
82 0.07
83 0.08
84 0.08
85 0.08
86 0.08
87 0.08
88 0.07
89 0.11
90 0.12
91 0.11
92 0.17
93 0.17
94 0.18
95 0.18
96 0.19
97 0.17
98 0.16
99 0.16
100 0.11
101 0.12
102 0.13
103 0.2
104 0.22
105 0.2
106 0.2
107 0.22
108 0.27
109 0.28
110 0.28
111 0.22
112 0.22
113 0.22
114 0.23
115 0.23
116 0.19
117 0.17
118 0.16
119 0.16
120 0.14
121 0.14
122 0.13
123 0.11
124 0.11
125 0.11
126 0.11
127 0.1