Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6FLL6

Protein Details
Accession Q6FLL6    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
263-284NTEAARRSRARKLQRMNQLETKHydrophilic
NLS Segment(s)
PositionSequence
267-273ARRSRAR
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003682  F:chromatin binding  
GO:0001228  F:DNA-binding transcription activator activity, RNA polymerase II-specific  
GO:0042802  F:identical protein binding  
GO:0043621  F:protein self-association  
GO:0000978  F:RNA polymerase II cis-regulatory region sequence-specific DNA binding  
GO:0061629  F:RNA polymerase II-specific DNA-binding transcription factor binding  
GO:0034198  P:cellular response to amino acid starvation  
GO:0035556  P:intracellular signal transduction  
GO:0010688  P:negative regulation of ribosomal protein gene transcription by RNA polymerase II  
GO:0001080  P:nitrogen catabolite activation of transcription from RNA polymerase II promoter  
GO:1903833  P:positive regulation of cellular response to amino acid starvation  
GO:0045899  P:positive regulation of RNA polymerase II transcription preinitiation complex assembly  
GO:1990139  P:protein localization to nuclear periphery  
KEGG cgr:CAGL0L02475g  -  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd12193  bZIP_GCN4  
cd12192  GCN4_cent  
Amino Acid Sequences MKMYVAQSNENVTKAGVPEFTNDKKVVVGELVFGKFNQDQQAILRDDSNAANNNYGDTLMDPTNAIPTDFFGSTIDQHFTNDNNDIDAAVVDAFFSSSTDSTPMFDYDDNQLAGNTVSGSSDNPENWTSLFDDDVEIKVEDVFGADAAGASITQFEQQKPEPVIAIKQEENSMGHNLIIPKTSFLPTPVIEDGKLDSSIKKANRVTKKSTVGSPVSPCLSSVKKDEKVDHLGVVVYNRKKRSQALTPVIPESDDPASLKRAKNTEAARRSRARKLQRMNQLETKVEELLKKNNELENEVRRLRGLLGESA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.17
4 0.16
5 0.19
6 0.26
7 0.29
8 0.32
9 0.31
10 0.29
11 0.28
12 0.28
13 0.25
14 0.2
15 0.17
16 0.15
17 0.19
18 0.19
19 0.19
20 0.18
21 0.21
22 0.19
23 0.22
24 0.24
25 0.2
26 0.2
27 0.22
28 0.29
29 0.27
30 0.27
31 0.25
32 0.21
33 0.22
34 0.23
35 0.24
36 0.22
37 0.2
38 0.22
39 0.21
40 0.21
41 0.19
42 0.18
43 0.14
44 0.1
45 0.13
46 0.11
47 0.11
48 0.1
49 0.1
50 0.14
51 0.13
52 0.13
53 0.09
54 0.1
55 0.14
56 0.13
57 0.14
58 0.11
59 0.12
60 0.14
61 0.16
62 0.16
63 0.13
64 0.14
65 0.15
66 0.15
67 0.16
68 0.18
69 0.16
70 0.15
71 0.15
72 0.14
73 0.12
74 0.11
75 0.08
76 0.05
77 0.05
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.05
84 0.05
85 0.05
86 0.07
87 0.07
88 0.08
89 0.1
90 0.1
91 0.11
92 0.11
93 0.12
94 0.13
95 0.16
96 0.15
97 0.14
98 0.13
99 0.12
100 0.12
101 0.1
102 0.07
103 0.05
104 0.05
105 0.05
106 0.05
107 0.06
108 0.08
109 0.08
110 0.1
111 0.11
112 0.11
113 0.11
114 0.12
115 0.11
116 0.1
117 0.1
118 0.08
119 0.08
120 0.08
121 0.09
122 0.09
123 0.08
124 0.07
125 0.07
126 0.07
127 0.06
128 0.05
129 0.05
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.02
137 0.02
138 0.03
139 0.03
140 0.05
141 0.07
142 0.07
143 0.1
144 0.11
145 0.15
146 0.15
147 0.16
148 0.14
149 0.13
150 0.15
151 0.14
152 0.17
153 0.14
154 0.14
155 0.14
156 0.14
157 0.14
158 0.14
159 0.13
160 0.1
161 0.1
162 0.11
163 0.11
164 0.11
165 0.12
166 0.1
167 0.1
168 0.11
169 0.12
170 0.11
171 0.11
172 0.14
173 0.13
174 0.16
175 0.17
176 0.16
177 0.15
178 0.15
179 0.15
180 0.13
181 0.14
182 0.11
183 0.1
184 0.11
185 0.17
186 0.18
187 0.24
188 0.27
189 0.36
190 0.45
191 0.5
192 0.55
193 0.58
194 0.63
195 0.59
196 0.57
197 0.54
198 0.47
199 0.45
200 0.41
201 0.35
202 0.3
203 0.28
204 0.25
205 0.23
206 0.22
207 0.21
208 0.25
209 0.31
210 0.35
211 0.38
212 0.41
213 0.43
214 0.47
215 0.46
216 0.4
217 0.32
218 0.26
219 0.24
220 0.24
221 0.25
222 0.25
223 0.3
224 0.32
225 0.35
226 0.37
227 0.42
228 0.47
229 0.49
230 0.53
231 0.55
232 0.59
233 0.59
234 0.57
235 0.52
236 0.45
237 0.35
238 0.28
239 0.21
240 0.16
241 0.14
242 0.14
243 0.19
244 0.24
245 0.27
246 0.29
247 0.32
248 0.34
249 0.41
250 0.46
251 0.52
252 0.56
253 0.6
254 0.62
255 0.67
256 0.7
257 0.72
258 0.74
259 0.74
260 0.75
261 0.78
262 0.8
263 0.82
264 0.83
265 0.81
266 0.8
267 0.74
268 0.66
269 0.58
270 0.52
271 0.44
272 0.39
273 0.36
274 0.32
275 0.36
276 0.37
277 0.39
278 0.4
279 0.41
280 0.41
281 0.42
282 0.45
283 0.45
284 0.49
285 0.47
286 0.43
287 0.4
288 0.39
289 0.35
290 0.32