Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2G448

Protein Details
Accession A0A0D2G448    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGKRKKSSSKPQGPKKREPLASTHydrophilic
NLS Segment(s)
PositionSequence
3-17KRKKSSSKPQGPKKR
Subcellular Location(s) cyto 15, cyto_mito 11.833, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSSKPQGPKKREPLASTFTCLFCNHEKAIQVKLDKKAGVGNLHCKVCGQRFQTGINYLSAAVDVYSDWIDACEDVAKDAASREAEDDAKFSSYAASGKAGAGIGAAEGGADEDEDVDYGDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.9
3 0.88
4 0.83
5 0.77
6 0.72
7 0.69
8 0.63
9 0.57
10 0.49
11 0.41
12 0.36
13 0.32
14 0.3
15 0.26
16 0.28
17 0.24
18 0.24
19 0.26
20 0.26
21 0.3
22 0.3
23 0.31
24 0.32
25 0.35
26 0.36
27 0.33
28 0.32
29 0.31
30 0.29
31 0.29
32 0.26
33 0.3
34 0.31
35 0.31
36 0.31
37 0.28
38 0.28
39 0.26
40 0.3
41 0.26
42 0.25
43 0.26
44 0.28
45 0.3
46 0.3
47 0.28
48 0.21
49 0.18
50 0.14
51 0.12
52 0.1
53 0.08
54 0.05
55 0.04
56 0.03
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.05
65 0.05
66 0.05
67 0.06
68 0.06
69 0.06
70 0.06
71 0.07
72 0.09
73 0.08
74 0.08
75 0.09
76 0.11
77 0.13
78 0.13
79 0.13
80 0.12
81 0.13
82 0.12
83 0.11
84 0.1
85 0.09
86 0.1
87 0.1
88 0.1
89 0.1
90 0.1
91 0.11
92 0.1
93 0.09
94 0.08
95 0.07
96 0.05
97 0.04
98 0.04
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.04
106 0.04
107 0.05