Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FT73

Protein Details
Accession Q6FT73   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
323-346SFYINSYKKGSKKKAEKEAEKAAAHydrophilic
NLS Segment(s)
PositionSequence
330-348KKGSKKKAEKEAEKAAAAS
353-366AVKTKSSKPSSRKA
Subcellular Location(s) plas 12, E.R. 6, mito 4, extr 2, vacu 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR030457  ELO_CS  
IPR002076  ELO_fam  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0016020  C:membrane  
GO:0009922  F:fatty acid elongase activity  
GO:0102756  F:very-long-chain 3-ketoacyl-CoA synthase activity  
GO:0030497  P:fatty acid elongation  
GO:0032511  P:late endosome to vacuole transport via multivesicular body sorting pathway  
GO:0006892  P:post-Golgi vesicle-mediated transport  
GO:0030148  P:sphingolipid biosynthetic process  
GO:0042761  P:very long-chain fatty acid biosynthetic process  
KEGG cgr:CAGL0G04851g  -  
Pfam View protein in Pfam  
PF01151  ELO  
PROSITE View protein in PROSITE  
PS01188  ELO  
Amino Acid Sequences MDQPVSQVTSAVASGAASAATAASSAAATAASVAVDQLEVLFQGAPSWIKVHTPSIDHPFGLELWPLFSAVFEKIAGYPAEDFRFIYNETFLANGYQAIGIIIFYYIVIFGGQAILRAINASPMHFHFLFQLHNLFLTSISFILMVLLIEQLVPMIYHHGLFWAICSPQAFAPKLVVLYYLNYLTKFVELFDTVFLIFKRKKLLFLHTYHHGATALLCYTQLVGETSVEWVPIVLNLGVHVVMYWYYFLSSCGIRVWWKQWVTRFQIIQFLIDLVFVYFATYTFYANKYFDGILPNKGTCYGTQDAAAYGYLILTSYLVLFISFYINSYKKGSKKKAEKEAEKAAAASATSSAVKTKSSKPSSRKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.04
10 0.04
11 0.04
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.05
28 0.05
29 0.05
30 0.05
31 0.07
32 0.08
33 0.09
34 0.1
35 0.1
36 0.12
37 0.14
38 0.19
39 0.2
40 0.24
41 0.28
42 0.35
43 0.36
44 0.34
45 0.32
46 0.28
47 0.26
48 0.23
49 0.19
50 0.11
51 0.1
52 0.11
53 0.11
54 0.09
55 0.09
56 0.09
57 0.09
58 0.1
59 0.08
60 0.09
61 0.09
62 0.12
63 0.12
64 0.11
65 0.12
66 0.15
67 0.17
68 0.16
69 0.17
70 0.15
71 0.17
72 0.17
73 0.16
74 0.14
75 0.12
76 0.12
77 0.12
78 0.11
79 0.09
80 0.08
81 0.07
82 0.07
83 0.06
84 0.06
85 0.06
86 0.05
87 0.04
88 0.04
89 0.04
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.04
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.06
105 0.06
106 0.09
107 0.09
108 0.09
109 0.11
110 0.12
111 0.17
112 0.17
113 0.17
114 0.15
115 0.16
116 0.17
117 0.16
118 0.17
119 0.12
120 0.12
121 0.12
122 0.1
123 0.08
124 0.08
125 0.07
126 0.05
127 0.06
128 0.05
129 0.05
130 0.05
131 0.04
132 0.04
133 0.04
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.02
142 0.05
143 0.05
144 0.06
145 0.06
146 0.06
147 0.06
148 0.06
149 0.07
150 0.07
151 0.06
152 0.07
153 0.08
154 0.08
155 0.1
156 0.14
157 0.14
158 0.13
159 0.14
160 0.13
161 0.13
162 0.12
163 0.11
164 0.07
165 0.08
166 0.08
167 0.09
168 0.09
169 0.09
170 0.09
171 0.08
172 0.09
173 0.08
174 0.07
175 0.07
176 0.07
177 0.07
178 0.07
179 0.07
180 0.06
181 0.07
182 0.07
183 0.11
184 0.12
185 0.13
186 0.19
187 0.19
188 0.25
189 0.27
190 0.34
191 0.36
192 0.39
193 0.41
194 0.39
195 0.41
196 0.36
197 0.33
198 0.26
199 0.19
200 0.16
201 0.13
202 0.09
203 0.07
204 0.06
205 0.06
206 0.06
207 0.05
208 0.06
209 0.05
210 0.05
211 0.05
212 0.06
213 0.07
214 0.07
215 0.07
216 0.06
217 0.06
218 0.05
219 0.05
220 0.06
221 0.05
222 0.04
223 0.05
224 0.05
225 0.05
226 0.05
227 0.05
228 0.04
229 0.04
230 0.04
231 0.04
232 0.04
233 0.05
234 0.05
235 0.06
236 0.07
237 0.07
238 0.08
239 0.09
240 0.1
241 0.12
242 0.15
243 0.17
244 0.23
245 0.25
246 0.29
247 0.34
248 0.41
249 0.45
250 0.49
251 0.48
252 0.42
253 0.46
254 0.43
255 0.37
256 0.29
257 0.22
258 0.16
259 0.14
260 0.13
261 0.06
262 0.06
263 0.05
264 0.05
265 0.05
266 0.05
267 0.08
268 0.08
269 0.09
270 0.11
271 0.13
272 0.15
273 0.16
274 0.16
275 0.16
276 0.16
277 0.16
278 0.21
279 0.22
280 0.25
281 0.27
282 0.27
283 0.25
284 0.27
285 0.26
286 0.2
287 0.24
288 0.21
289 0.19
290 0.19
291 0.19
292 0.18
293 0.18
294 0.17
295 0.11
296 0.08
297 0.07
298 0.06
299 0.05
300 0.05
301 0.04
302 0.04
303 0.04
304 0.05
305 0.05
306 0.05
307 0.05
308 0.05
309 0.08
310 0.07
311 0.08
312 0.15
313 0.16
314 0.19
315 0.24
316 0.31
317 0.36
318 0.47
319 0.56
320 0.6
321 0.7
322 0.78
323 0.83
324 0.87
325 0.88
326 0.85
327 0.86
328 0.8
329 0.7
330 0.6
331 0.5
332 0.4
333 0.32
334 0.24
335 0.14
336 0.11
337 0.11
338 0.11
339 0.13
340 0.13
341 0.17
342 0.21
343 0.29
344 0.38
345 0.46
346 0.56