Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0R0LUL0

Protein Details
Accession A0A0R0LUL0    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
33-52LHFWRIKSVKVQKVKNRTCLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto 7, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001509  Epimerase_deHydtase  
IPR036291  NAD(P)-bd_dom_sf  
IPR002347  SDR_fam  
Pfam View protein in Pfam  
PF01370  Epimerase  
Amino Acid Sequences FKCFISWIGNKIWLPYPLKLLIITSTELLMNFLHFWRIKSVKVQKVKNRTCLITGGSKSIGRKLVLFLKEAGYDITVLSRTSPKIDNVKWIKLDLSDIEEIHNFKFEQQIDLLVLNAGILTEKFDQIDLNFKVNFLSHYLLYENIKSCLHDQSRVVLTSSCMGLTISDFNPFEKSSIKGKKYAESKFCVFLLGRYISKTYQTVILHPGIIPTELFNGSLERFIVLKLLYFFTNSINEGANVLLNACQTHILPNHRLIFFYGFDRMEIPKSITKVNLNRLLEITKKILL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.38
4 0.33
5 0.34
6 0.31
7 0.27
8 0.24
9 0.22
10 0.21
11 0.16
12 0.15
13 0.14
14 0.14
15 0.14
16 0.11
17 0.1
18 0.1
19 0.1
20 0.15
21 0.16
22 0.17
23 0.24
24 0.27
25 0.28
26 0.36
27 0.46
28 0.49
29 0.57
30 0.65
31 0.66
32 0.75
33 0.81
34 0.8
35 0.76
36 0.69
37 0.62
38 0.56
39 0.5
40 0.47
41 0.41
42 0.35
43 0.31
44 0.31
45 0.3
46 0.32
47 0.32
48 0.25
49 0.24
50 0.25
51 0.3
52 0.29
53 0.3
54 0.26
55 0.24
56 0.24
57 0.23
58 0.2
59 0.12
60 0.11
61 0.09
62 0.09
63 0.08
64 0.07
65 0.09
66 0.11
67 0.11
68 0.14
69 0.17
70 0.2
71 0.27
72 0.29
73 0.37
74 0.39
75 0.44
76 0.41
77 0.4
78 0.36
79 0.29
80 0.29
81 0.2
82 0.19
83 0.15
84 0.14
85 0.15
86 0.15
87 0.16
88 0.14
89 0.15
90 0.11
91 0.1
92 0.15
93 0.14
94 0.14
95 0.14
96 0.14
97 0.13
98 0.13
99 0.13
100 0.08
101 0.07
102 0.05
103 0.05
104 0.04
105 0.03
106 0.03
107 0.05
108 0.06
109 0.06
110 0.07
111 0.07
112 0.07
113 0.08
114 0.15
115 0.14
116 0.16
117 0.15
118 0.15
119 0.16
120 0.16
121 0.16
122 0.11
123 0.11
124 0.08
125 0.09
126 0.1
127 0.11
128 0.11
129 0.13
130 0.11
131 0.11
132 0.11
133 0.11
134 0.12
135 0.18
136 0.18
137 0.19
138 0.18
139 0.21
140 0.23
141 0.23
142 0.22
143 0.16
144 0.15
145 0.14
146 0.13
147 0.09
148 0.07
149 0.06
150 0.06
151 0.06
152 0.08
153 0.08
154 0.1
155 0.11
156 0.11
157 0.13
158 0.13
159 0.13
160 0.12
161 0.15
162 0.21
163 0.29
164 0.31
165 0.35
166 0.36
167 0.42
168 0.48
169 0.53
170 0.49
171 0.46
172 0.46
173 0.43
174 0.41
175 0.37
176 0.29
177 0.23
178 0.22
179 0.2
180 0.18
181 0.17
182 0.19
183 0.18
184 0.2
185 0.2
186 0.15
187 0.19
188 0.19
189 0.19
190 0.22
191 0.22
192 0.2
193 0.19
194 0.19
195 0.13
196 0.13
197 0.11
198 0.08
199 0.09
200 0.09
201 0.09
202 0.09
203 0.1
204 0.1
205 0.11
206 0.1
207 0.09
208 0.09
209 0.08
210 0.1
211 0.08
212 0.09
213 0.1
214 0.12
215 0.11
216 0.12
217 0.13
218 0.13
219 0.16
220 0.15
221 0.15
222 0.14
223 0.14
224 0.13
225 0.13
226 0.11
227 0.09
228 0.08
229 0.08
230 0.07
231 0.07
232 0.07
233 0.08
234 0.08
235 0.13
236 0.18
237 0.23
238 0.27
239 0.33
240 0.39
241 0.39
242 0.39
243 0.37
244 0.35
245 0.3
246 0.29
247 0.27
248 0.21
249 0.21
250 0.23
251 0.22
252 0.22
253 0.22
254 0.24
255 0.24
256 0.26
257 0.28
258 0.31
259 0.38
260 0.42
261 0.5
262 0.54
263 0.51
264 0.51
265 0.51
266 0.51
267 0.46
268 0.42