Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0R0M050

Protein Details
Accession A0A0R0M050    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
32-57VLDKRENRKLIKYKKERRWMICQLAKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 13.833, mito_nucl 13.499
Family & Domain DBs
Amino Acid Sequences MMNSLQQPQEEVLNKLLDSDKYTHYAINIKNVLDKRENRKLIKYKKERRWMICQLAKWYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.23
4 0.18
5 0.18
6 0.19
7 0.18
8 0.19
9 0.2
10 0.19
11 0.18
12 0.23
13 0.21
14 0.25
15 0.24
16 0.21
17 0.25
18 0.26
19 0.28
20 0.28
21 0.33
22 0.35
23 0.43
24 0.5
25 0.48
26 0.57
27 0.64
28 0.68
29 0.73
30 0.76
31 0.77
32 0.8
33 0.88
34 0.88
35 0.85
36 0.84
37 0.83
38 0.83
39 0.79
40 0.73