Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0R0LRG7

Protein Details
Accession A0A0R0LRG7    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
38-57LLRNCKRKIKWTEKYELVRQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR043128  Rev_trsase/Diguanyl_cyclase  
Amino Acid Sequences MSNPPKTKKDLQKLLGIFQWFRNFVKDISLLMLPLTDLLRNCKRKIKWTEKYELVRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.57
3 0.48
4 0.39
5 0.33
6 0.33
7 0.27
8 0.25
9 0.25
10 0.23
11 0.2
12 0.22
13 0.19
14 0.15
15 0.15
16 0.14
17 0.11
18 0.09
19 0.09
20 0.06
21 0.06
22 0.06
23 0.06
24 0.06
25 0.14
26 0.23
27 0.28
28 0.31
29 0.39
30 0.42
31 0.51
32 0.62
33 0.66
34 0.67
35 0.71
36 0.77
37 0.78