Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0R0M3Y2

Protein Details
Accession A0A0R0M3Y2    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGRKKSRRTQIKGRAKPRAPTSFHydrophilic
NLS Segment(s)
PositionSequence
3-18RKKSRRTQIKGRAKPR
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 8.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGRKKSRRTQIKGRAKPRAPTSFDCPECHAEGTVRVTISRKKTATAFCTICDAKYLTSANRLTASIDVYTKWVDEKNAKTYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.83
3 0.82
4 0.8
5 0.78
6 0.73
7 0.67
8 0.65
9 0.64
10 0.61
11 0.55
12 0.5
13 0.44
14 0.39
15 0.35
16 0.28
17 0.19
18 0.19
19 0.19
20 0.17
21 0.14
22 0.13
23 0.14
24 0.19
25 0.23
26 0.26
27 0.24
28 0.24
29 0.28
30 0.32
31 0.33
32 0.35
33 0.31
34 0.26
35 0.31
36 0.3
37 0.26
38 0.23
39 0.2
40 0.14
41 0.16
42 0.18
43 0.13
44 0.2
45 0.21
46 0.2
47 0.21
48 0.21
49 0.19
50 0.18
51 0.19
52 0.14
53 0.14
54 0.13
55 0.14
56 0.14
57 0.13
58 0.14
59 0.14
60 0.18
61 0.25
62 0.3