Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0R0M7Q6

Protein Details
Accession A0A0R0M7Q6    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
67-96DEKTWRDYCKRQREGKWGRRRDDKRDEHRDBasic
NLS Segment(s)
PositionSequence
81-89GKWGRRRDD
Subcellular Location(s) nucl 17, cyto_nucl 14, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR007854  Fip1_dom  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF05182  Fip1  
Amino Acid Sequences MADQDVLFNIEDSSSSDGENIDIEQTPTNPNILNENNLDFIDLDDLSEFPWRKPGADITDYFNYGFDEKTWRDYCKRQREGKWGRRRDDKRDEHRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.11
5 0.11
6 0.12
7 0.1
8 0.08
9 0.08
10 0.09
11 0.09
12 0.1
13 0.12
14 0.12
15 0.12
16 0.12
17 0.12
18 0.16
19 0.16
20 0.18
21 0.17
22 0.18
23 0.18
24 0.17
25 0.17
26 0.12
27 0.11
28 0.09
29 0.08
30 0.06
31 0.05
32 0.05
33 0.05
34 0.09
35 0.1
36 0.08
37 0.14
38 0.14
39 0.14
40 0.16
41 0.19
42 0.2
43 0.23
44 0.24
45 0.24
46 0.26
47 0.27
48 0.25
49 0.22
50 0.18
51 0.15
52 0.14
53 0.09
54 0.14
55 0.14
56 0.21
57 0.24
58 0.27
59 0.32
60 0.41
61 0.51
62 0.56
63 0.65
64 0.67
65 0.72
66 0.79
67 0.85
68 0.86
69 0.87
70 0.85
71 0.84
72 0.86
73 0.85
74 0.84
75 0.84
76 0.84