Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0R0M1G1

Protein Details
Accession A0A0R0M1G1    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
84-113AMLATKKCFKNRKRKSQKLRTKVWQKFQNFHydrophilic
NLS Segment(s)
PositionSequence
94-101NRKRKSQK
Subcellular Location(s) nucl 19, mito 6
Family & Domain DBs
Amino Acid Sequences MIRLATNSQQLGSNSYEISRQIELPNTNIHDIVKSLNVYSITSDFLLRALVDCIDALHICFEAYFFVRRRAFSTIFDENVLRAAMLATKKCFKNRKRKSQKLRTKVWQKFQNFVGKFQVLILRGFFRLDFVLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.2
4 0.17
5 0.19
6 0.17
7 0.17
8 0.17
9 0.23
10 0.23
11 0.24
12 0.28
13 0.27
14 0.27
15 0.25
16 0.23
17 0.18
18 0.17
19 0.17
20 0.14
21 0.12
22 0.11
23 0.13
24 0.13
25 0.13
26 0.14
27 0.13
28 0.12
29 0.11
30 0.11
31 0.09
32 0.09
33 0.09
34 0.07
35 0.07
36 0.06
37 0.06
38 0.05
39 0.05
40 0.05
41 0.06
42 0.06
43 0.05
44 0.05
45 0.05
46 0.04
47 0.04
48 0.04
49 0.04
50 0.06
51 0.09
52 0.1
53 0.17
54 0.18
55 0.19
56 0.21
57 0.25
58 0.26
59 0.25
60 0.3
61 0.26
62 0.25
63 0.26
64 0.23
65 0.19
66 0.18
67 0.15
68 0.09
69 0.06
70 0.05
71 0.07
72 0.1
73 0.12
74 0.13
75 0.19
76 0.22
77 0.3
78 0.4
79 0.46
80 0.55
81 0.64
82 0.73
83 0.79
84 0.88
85 0.91
86 0.93
87 0.95
88 0.93
89 0.92
90 0.91
91 0.9
92 0.88
93 0.87
94 0.85
95 0.77
96 0.73
97 0.69
98 0.69
99 0.59
100 0.54
101 0.51
102 0.42
103 0.39
104 0.35
105 0.34
106 0.25
107 0.25
108 0.24
109 0.19
110 0.19
111 0.2
112 0.18
113 0.16