Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0R0M6X8

Protein Details
Accession A0A0R0M6X8    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-30YSAQNYQKFLQKQKKEEKKNEVDIEIHydrophilic
117-140AFTSEKKKTKEKQQKVKNLPPKEIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR031547  DUF5089  
Pfam View protein in Pfam  
PF17002  DUF5089  
Amino Acid Sequences MKDLYSAQNYQKFLQKQKKEEKKNEVDIEIEQKAKEIEQQNYQMAKAARIKLEQGYSTQKKTTKELLSQGEKLEKASADAEEIDENIQEGKYLAKKIEEEGKLFNFKVPFLGTIKNAFTSEKKKTKEKQQKVKNLPPKEITSINSLNIPKKNLLPGQEKTDEELAKIYLTLKNVNQGAKFQHEEIERQQKNIKNISDRSKKSKDNMEEVEEKLKNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.61
3 0.65
4 0.74
5 0.82
6 0.84
7 0.88
8 0.89
9 0.88
10 0.89
11 0.83
12 0.74
13 0.65
14 0.57
15 0.53
16 0.45
17 0.37
18 0.27
19 0.23
20 0.22
21 0.2
22 0.24
23 0.24
24 0.25
25 0.3
26 0.35
27 0.4
28 0.4
29 0.4
30 0.38
31 0.32
32 0.33
33 0.33
34 0.32
35 0.29
36 0.29
37 0.31
38 0.3
39 0.32
40 0.28
41 0.25
42 0.31
43 0.33
44 0.35
45 0.37
46 0.38
47 0.38
48 0.42
49 0.46
50 0.41
51 0.42
52 0.46
53 0.49
54 0.49
55 0.49
56 0.46
57 0.41
58 0.36
59 0.32
60 0.27
61 0.19
62 0.15
63 0.15
64 0.13
65 0.1
66 0.1
67 0.1
68 0.08
69 0.08
70 0.07
71 0.06
72 0.06
73 0.05
74 0.05
75 0.04
76 0.04
77 0.06
78 0.08
79 0.1
80 0.1
81 0.11
82 0.12
83 0.13
84 0.22
85 0.21
86 0.2
87 0.22
88 0.23
89 0.24
90 0.24
91 0.24
92 0.16
93 0.15
94 0.15
95 0.12
96 0.12
97 0.11
98 0.13
99 0.12
100 0.14
101 0.15
102 0.14
103 0.14
104 0.14
105 0.16
106 0.2
107 0.27
108 0.33
109 0.36
110 0.43
111 0.49
112 0.59
113 0.67
114 0.71
115 0.74
116 0.76
117 0.83
118 0.85
119 0.88
120 0.87
121 0.8
122 0.75
123 0.68
124 0.61
125 0.54
126 0.48
127 0.39
128 0.36
129 0.33
130 0.28
131 0.29
132 0.28
133 0.3
134 0.29
135 0.3
136 0.25
137 0.26
138 0.3
139 0.28
140 0.32
141 0.34
142 0.35
143 0.39
144 0.42
145 0.4
146 0.38
147 0.4
148 0.34
149 0.27
150 0.26
151 0.19
152 0.15
153 0.15
154 0.14
155 0.11
156 0.13
157 0.16
158 0.16
159 0.22
160 0.24
161 0.27
162 0.26
163 0.27
164 0.29
165 0.31
166 0.33
167 0.27
168 0.3
169 0.29
170 0.32
171 0.37
172 0.45
173 0.4
174 0.41
175 0.47
176 0.46
177 0.51
178 0.55
179 0.53
180 0.5
181 0.57
182 0.64
183 0.68
184 0.69
185 0.72
186 0.73
187 0.73
188 0.72
189 0.75
190 0.71
191 0.7
192 0.69
193 0.67
194 0.63
195 0.59
196 0.61