Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6CJ96

Protein Details
Accession Q6CJ96   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
220-239ITIKSFKKRDELKNENKSTYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 6
Family & Domain DBs
KEGG kla:KLLA0_F20339g  -  
Amino Acid Sequences MSNQEATGSWQFLHINNDISLAKITKESSSSIIGVLKLCEDEKFLRFRVSSEQIPKELGCSNGVDSISELYNILTKGVEGSSIVAMDKKIIISIQRKKASSVEIETAIIAITGEHLTQLLLECNTYLMRNVLVLNYVQNYTSHTALEKDRAIEFLGNTAKDYGANNAILRWAPENSLNYRALMKYKPELVLQESAPDKIINSDAVNLFELNDSMKNNGTITIKSFKKRDELKNENKSTYDTWESNFSEEELDDDSLLDKFDLKDDLKMQVARLKPAQKDAGSDSDTDLEYESPTKRARTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.22
4 0.25
5 0.22
6 0.22
7 0.22
8 0.18
9 0.17
10 0.16
11 0.18
12 0.16
13 0.18
14 0.19
15 0.19
16 0.21
17 0.21
18 0.2
19 0.21
20 0.2
21 0.19
22 0.17
23 0.15
24 0.14
25 0.14
26 0.12
27 0.14
28 0.17
29 0.2
30 0.24
31 0.25
32 0.28
33 0.28
34 0.29
35 0.34
36 0.36
37 0.39
38 0.43
39 0.46
40 0.42
41 0.44
42 0.42
43 0.36
44 0.33
45 0.27
46 0.2
47 0.17
48 0.17
49 0.19
50 0.19
51 0.16
52 0.14
53 0.14
54 0.13
55 0.12
56 0.11
57 0.07
58 0.1
59 0.1
60 0.1
61 0.08
62 0.07
63 0.08
64 0.08
65 0.08
66 0.05
67 0.07
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.08
74 0.08
75 0.07
76 0.07
77 0.07
78 0.13
79 0.21
80 0.3
81 0.39
82 0.43
83 0.44
84 0.46
85 0.47
86 0.45
87 0.4
88 0.35
89 0.28
90 0.24
91 0.24
92 0.21
93 0.19
94 0.15
95 0.11
96 0.07
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.07
118 0.06
119 0.06
120 0.06
121 0.07
122 0.07
123 0.08
124 0.07
125 0.07
126 0.09
127 0.1
128 0.11
129 0.1
130 0.09
131 0.11
132 0.12
133 0.15
134 0.13
135 0.13
136 0.13
137 0.13
138 0.13
139 0.12
140 0.11
141 0.12
142 0.13
143 0.11
144 0.11
145 0.11
146 0.11
147 0.11
148 0.11
149 0.09
150 0.09
151 0.1
152 0.1
153 0.09
154 0.1
155 0.09
156 0.1
157 0.09
158 0.08
159 0.08
160 0.11
161 0.14
162 0.15
163 0.19
164 0.19
165 0.18
166 0.19
167 0.19
168 0.19
169 0.19
170 0.19
171 0.18
172 0.2
173 0.21
174 0.21
175 0.22
176 0.22
177 0.23
178 0.2
179 0.22
180 0.19
181 0.18
182 0.18
183 0.16
184 0.13
185 0.11
186 0.12
187 0.09
188 0.09
189 0.12
190 0.11
191 0.13
192 0.13
193 0.12
194 0.12
195 0.1
196 0.1
197 0.08
198 0.09
199 0.09
200 0.1
201 0.11
202 0.11
203 0.11
204 0.14
205 0.15
206 0.14
207 0.17
208 0.24
209 0.27
210 0.32
211 0.35
212 0.34
213 0.41
214 0.49
215 0.55
216 0.58
217 0.64
218 0.7
219 0.78
220 0.8
221 0.73
222 0.65
223 0.59
224 0.5
225 0.46
226 0.41
227 0.32
228 0.28
229 0.33
230 0.33
231 0.31
232 0.29
233 0.24
234 0.19
235 0.18
236 0.17
237 0.13
238 0.12
239 0.11
240 0.11
241 0.11
242 0.1
243 0.1
244 0.09
245 0.08
246 0.08
247 0.1
248 0.15
249 0.15
250 0.19
251 0.21
252 0.24
253 0.28
254 0.28
255 0.29
256 0.3
257 0.31
258 0.33
259 0.38
260 0.41
261 0.39
262 0.45
263 0.5
264 0.45
265 0.47
266 0.46
267 0.46
268 0.4
269 0.38
270 0.33
271 0.29
272 0.28
273 0.24
274 0.21
275 0.14
276 0.14
277 0.18
278 0.17
279 0.2
280 0.23