Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0R0M085

Protein Details
Accession A0A0R0M085    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
45-66LSDRRTSYKKSTQKPTIRKSKFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004308  GCS  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004357  F:glutamate-cysteine ligase activity  
GO:0006750  P:glutathione biosynthetic process  
Pfam View protein in Pfam  
PF03074  GCS  
Amino Acid Sequences HEVSSSDTESSETIFLKDGPSKTGPSEEYYFAKNRSLIDQFMVCLSDRRTSYKKSTQKPTIRKSKFSCSDMFISEDAFQFNDTEVSYRQEHLDYLVNQKVDVTMAKYIASLFIRDPLVNIKEYMSSNDNEDTENLYEFLNIQSNNFKSTMLKLPIDDGWRVELRSIEIQVTPYENY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.15
4 0.21
5 0.2
6 0.23
7 0.25
8 0.26
9 0.27
10 0.31
11 0.29
12 0.29
13 0.31
14 0.29
15 0.29
16 0.31
17 0.33
18 0.3
19 0.31
20 0.27
21 0.26
22 0.27
23 0.28
24 0.25
25 0.24
26 0.23
27 0.2
28 0.19
29 0.19
30 0.14
31 0.14
32 0.15
33 0.17
34 0.18
35 0.24
36 0.27
37 0.31
38 0.39
39 0.46
40 0.53
41 0.57
42 0.66
43 0.7
44 0.76
45 0.8
46 0.82
47 0.83
48 0.78
49 0.78
50 0.73
51 0.73
52 0.7
53 0.64
54 0.56
55 0.49
56 0.46
57 0.39
58 0.36
59 0.26
60 0.2
61 0.18
62 0.16
63 0.12
64 0.1
65 0.09
66 0.07
67 0.07
68 0.07
69 0.06
70 0.07
71 0.07
72 0.1
73 0.11
74 0.11
75 0.11
76 0.11
77 0.11
78 0.12
79 0.15
80 0.13
81 0.17
82 0.18
83 0.18
84 0.17
85 0.17
86 0.15
87 0.12
88 0.11
89 0.09
90 0.07
91 0.08
92 0.08
93 0.08
94 0.08
95 0.1
96 0.1
97 0.09
98 0.08
99 0.11
100 0.12
101 0.12
102 0.13
103 0.15
104 0.16
105 0.16
106 0.16
107 0.14
108 0.16
109 0.16
110 0.19
111 0.17
112 0.16
113 0.17
114 0.19
115 0.19
116 0.17
117 0.17
118 0.17
119 0.15
120 0.15
121 0.13
122 0.11
123 0.11
124 0.11
125 0.11
126 0.13
127 0.12
128 0.12
129 0.19
130 0.2
131 0.22
132 0.22
133 0.21
134 0.18
135 0.23
136 0.3
137 0.28
138 0.29
139 0.27
140 0.3
141 0.33
142 0.34
143 0.31
144 0.24
145 0.24
146 0.24
147 0.24
148 0.23
149 0.2
150 0.21
151 0.24
152 0.24
153 0.21
154 0.2
155 0.21
156 0.22