Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0R0LY90

Protein Details
Accession A0A0R0LY90    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-33ITTSSIKKLIKKLKKKRKASPESIKLLAHydrophilic
NLS Segment(s)
PositionSequence
12-25KKLIKKLKKKRKAS
Subcellular Location(s) nucl 12.5, cyto_nucl 7.5, mito 5, vacu 3, plas 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Amino Acid Sequences MSQNQITTSSIKKLIKKLKKKRKASPESIKLLAAIVGYTTAFIVASAKDLSEDDGSSFLRNSDLRKVFSTFGLEKLYDDTYKEFLAEYVNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.61
3 0.69
4 0.76
5 0.8
6 0.85
7 0.9
8 0.91
9 0.91
10 0.91
11 0.9
12 0.9
13 0.87
14 0.83
15 0.75
16 0.64
17 0.53
18 0.43
19 0.33
20 0.21
21 0.12
22 0.06
23 0.05
24 0.04
25 0.04
26 0.04
27 0.03
28 0.03
29 0.03
30 0.04
31 0.03
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.07
38 0.07
39 0.07
40 0.06
41 0.08
42 0.09
43 0.09
44 0.09
45 0.07
46 0.09
47 0.1
48 0.12
49 0.2
50 0.23
51 0.25
52 0.28
53 0.3
54 0.29
55 0.3
56 0.33
57 0.25
58 0.25
59 0.26
60 0.23
61 0.21
62 0.23
63 0.24
64 0.19
65 0.19
66 0.19
67 0.18
68 0.18
69 0.18
70 0.16
71 0.13