Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0R0LRH6

Protein Details
Accession A0A0R0LRH6    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
243-262LKMVRLETTHRKRNIKFKACHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 12.5, cyto 7.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014811  ArgoL1  
IPR032474  Argonaute_N  
IPR036085  PAZ_dom_sf  
Pfam View protein in Pfam  
PF08699  ArgoL1  
PF16486  ArgoN  
Amino Acid Sequences MTAVIGSELMLRPTNITPGNVPLTTNLLAMKVPTIELCHYAVSIEPMIAKRLNNIVIKNVLEQNKDKFKGCVYGYDGNFMIVTNKKIENIIQQEKVGSKEITVKIEFKNLYNSSIDELIKSVSEKVIDNDEQGNKTKHESTMQCLEILLRSYQAEKYLVDGRRIVTDSQRDSLSGCIEVWYGVSQRIKMLNGGLFLNVDCSHMMFYEPLTLIQIIEKQQSRRGEYVDLARLGSYVFRDLSKFLKMVRLETTHRKRNIKFKACDITETSAHDTVFGITQQGGDGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.22
4 0.21
5 0.26
6 0.3
7 0.27
8 0.27
9 0.22
10 0.25
11 0.24
12 0.23
13 0.18
14 0.14
15 0.14
16 0.14
17 0.14
18 0.1
19 0.09
20 0.09
21 0.12
22 0.12
23 0.15
24 0.15
25 0.14
26 0.14
27 0.14
28 0.13
29 0.13
30 0.12
31 0.1
32 0.11
33 0.12
34 0.15
35 0.17
36 0.16
37 0.16
38 0.2
39 0.26
40 0.27
41 0.28
42 0.28
43 0.3
44 0.31
45 0.32
46 0.33
47 0.31
48 0.31
49 0.33
50 0.37
51 0.42
52 0.43
53 0.42
54 0.37
55 0.35
56 0.38
57 0.36
58 0.34
59 0.31
60 0.37
61 0.35
62 0.37
63 0.35
64 0.28
65 0.27
66 0.21
67 0.19
68 0.13
69 0.14
70 0.15
71 0.15
72 0.15
73 0.16
74 0.18
75 0.22
76 0.28
77 0.32
78 0.3
79 0.3
80 0.31
81 0.32
82 0.32
83 0.28
84 0.2
85 0.15
86 0.21
87 0.23
88 0.25
89 0.25
90 0.26
91 0.24
92 0.29
93 0.29
94 0.23
95 0.28
96 0.25
97 0.26
98 0.24
99 0.23
100 0.19
101 0.21
102 0.2
103 0.13
104 0.12
105 0.11
106 0.1
107 0.1
108 0.09
109 0.06
110 0.07
111 0.08
112 0.09
113 0.13
114 0.13
115 0.13
116 0.16
117 0.17
118 0.18
119 0.2
120 0.21
121 0.17
122 0.19
123 0.19
124 0.17
125 0.21
126 0.21
127 0.22
128 0.26
129 0.26
130 0.24
131 0.22
132 0.21
133 0.16
134 0.16
135 0.12
136 0.07
137 0.07
138 0.08
139 0.09
140 0.1
141 0.1
142 0.09
143 0.12
144 0.18
145 0.19
146 0.2
147 0.2
148 0.2
149 0.21
150 0.23
151 0.21
152 0.18
153 0.21
154 0.22
155 0.23
156 0.22
157 0.2
158 0.19
159 0.2
160 0.16
161 0.12
162 0.1
163 0.08
164 0.08
165 0.08
166 0.08
167 0.07
168 0.07
169 0.1
170 0.11
171 0.11
172 0.13
173 0.15
174 0.15
175 0.15
176 0.16
177 0.14
178 0.15
179 0.15
180 0.13
181 0.11
182 0.1
183 0.12
184 0.1
185 0.09
186 0.08
187 0.08
188 0.08
189 0.08
190 0.09
191 0.07
192 0.07
193 0.1
194 0.1
195 0.1
196 0.11
197 0.11
198 0.1
199 0.11
200 0.14
201 0.12
202 0.17
203 0.21
204 0.22
205 0.28
206 0.33
207 0.37
208 0.36
209 0.37
210 0.34
211 0.34
212 0.38
213 0.37
214 0.33
215 0.28
216 0.26
217 0.23
218 0.2
219 0.18
220 0.13
221 0.1
222 0.1
223 0.11
224 0.12
225 0.14
226 0.17
227 0.19
228 0.19
229 0.18
230 0.24
231 0.25
232 0.26
233 0.31
234 0.33
235 0.36
236 0.46
237 0.54
238 0.56
239 0.63
240 0.69
241 0.7
242 0.75
243 0.8
244 0.8
245 0.75
246 0.75
247 0.77
248 0.7
249 0.68
250 0.63
251 0.57
252 0.49
253 0.48
254 0.44
255 0.36
256 0.34
257 0.3
258 0.26
259 0.22
260 0.21
261 0.16
262 0.13
263 0.1
264 0.11