Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0R0LQH5

Protein Details
Accession A0A0R0LQH5    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
87-115GEEKVALSKKKKEKKRRKTEMYQRFEKLFBasic
NLS Segment(s)
PositionSequence
94-104SKKKKEKKRRK
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR043128  Rev_trsase/Diguanyl_cyclase  
IPR000477  RT_dom  
Pfam View protein in Pfam  
PF00078  RVT_1  
PROSITE View protein in PROSITE  
PS50878  RT_POL  
Amino Acid Sequences MNGMVMGYKNSPMIMQRTMNQIFDDMIGKSVMIYLDDTIIFDRDINEHKNNIEEVIRRLNKNNFRVNPLKIQFCQNVVKILGMIINGEEKVALSKKKKEKKRRKTEMYQRFEKLFRQCRMVPNIYQEFCRKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.24
4 0.32
5 0.34
6 0.34
7 0.31
8 0.28
9 0.23
10 0.21
11 0.2
12 0.12
13 0.11
14 0.1
15 0.09
16 0.08
17 0.09
18 0.08
19 0.07
20 0.07
21 0.06
22 0.07
23 0.07
24 0.08
25 0.08
26 0.08
27 0.08
28 0.07
29 0.07
30 0.08
31 0.12
32 0.16
33 0.18
34 0.19
35 0.19
36 0.2
37 0.2
38 0.19
39 0.18
40 0.15
41 0.16
42 0.24
43 0.26
44 0.26
45 0.3
46 0.36
47 0.41
48 0.46
49 0.51
50 0.44
51 0.47
52 0.5
53 0.48
54 0.49
55 0.44
56 0.41
57 0.34
58 0.37
59 0.32
60 0.31
61 0.32
62 0.24
63 0.24
64 0.21
65 0.2
66 0.15
67 0.14
68 0.12
69 0.08
70 0.07
71 0.05
72 0.06
73 0.05
74 0.05
75 0.05
76 0.04
77 0.07
78 0.1
79 0.15
80 0.19
81 0.29
82 0.39
83 0.49
84 0.59
85 0.68
86 0.77
87 0.83
88 0.9
89 0.92
90 0.92
91 0.94
92 0.94
93 0.94
94 0.91
95 0.88
96 0.81
97 0.74
98 0.66
99 0.62
100 0.61
101 0.6
102 0.54
103 0.53
104 0.53
105 0.57
106 0.63
107 0.62
108 0.55
109 0.54
110 0.6
111 0.54
112 0.54