Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0R0LWE8

Protein Details
Accession A0A0R0LWE8    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
94-123DIDRVRKELLNKRKRDKKGNCFIERRQTDRBasic
NLS Segment(s)
PositionSequence
105-111KRKRDKK
Subcellular Location(s) nucl 20.5, mito_nucl 13, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001584  Integrase_cat-core  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0015074  P:DNA integration  
PROSITE View protein in PROSITE  
PS50994  INTEGRASE  
Amino Acid Sequences MNSRYTTTSTYHPQSNGTTERFNKTFIKKLAKMFGGDLSKWSEMIEPARFAYNTTPISSLKASPFKILYGRDVYDFRMEEMVGKESCHNKTLDDIDRVRKELLNKRKRDKKGNCFIERRQTDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.4
4 0.36
5 0.39
6 0.38
7 0.44
8 0.41
9 0.42
10 0.43
11 0.43
12 0.48
13 0.48
14 0.54
15 0.51
16 0.55
17 0.59
18 0.53
19 0.49
20 0.42
21 0.41
22 0.35
23 0.3
24 0.27
25 0.23
26 0.22
27 0.2
28 0.19
29 0.14
30 0.12
31 0.16
32 0.16
33 0.13
34 0.13
35 0.15
36 0.14
37 0.14
38 0.15
39 0.17
40 0.16
41 0.16
42 0.17
43 0.16
44 0.18
45 0.18
46 0.18
47 0.16
48 0.19
49 0.19
50 0.19
51 0.19
52 0.18
53 0.2
54 0.19
55 0.19
56 0.17
57 0.17
58 0.18
59 0.18
60 0.19
61 0.19
62 0.18
63 0.16
64 0.14
65 0.13
66 0.13
67 0.14
68 0.16
69 0.13
70 0.13
71 0.16
72 0.2
73 0.22
74 0.22
75 0.21
76 0.18
77 0.22
78 0.28
79 0.3
80 0.31
81 0.33
82 0.4
83 0.42
84 0.44
85 0.41
86 0.38
87 0.4
88 0.44
89 0.52
90 0.53
91 0.6
92 0.68
93 0.77
94 0.83
95 0.86
96 0.87
97 0.87
98 0.88
99 0.9
100 0.89
101 0.87
102 0.85
103 0.85