Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0R0LUI6

Protein Details
Accession A0A0R0LUI6    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-28MRQIRPRHPYNTRSNKVKKVRTPGGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MVMRQIRPRHPYNTRSNKVKKVRTPGGKLVFHNIKKKISLPSCSICKEKLQGIRRATNAGYKLLKRKHRTVSRIFGGNTCAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.78
3 0.8
4 0.81
5 0.83
6 0.83
7 0.8
8 0.78
9 0.8
10 0.79
11 0.77
12 0.76
13 0.75
14 0.69
15 0.62
16 0.6
17 0.59
18 0.55
19 0.55
20 0.49
21 0.43
22 0.41
23 0.42
24 0.42
25 0.38
26 0.37
27 0.34
28 0.35
29 0.37
30 0.39
31 0.38
32 0.31
33 0.29
34 0.27
35 0.28
36 0.32
37 0.35
38 0.4
39 0.44
40 0.48
41 0.47
42 0.47
43 0.43
44 0.4
45 0.35
46 0.32
47 0.32
48 0.3
49 0.38
50 0.43
51 0.52
52 0.54
53 0.61
54 0.66
55 0.71
56 0.76
57 0.76
58 0.78
59 0.75
60 0.75
61 0.68
62 0.59