Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0R0LXK2

Protein Details
Accession A0A0R0LXK2    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-24SSNYCVKVIKNRIKKFNMKGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR012164  Rpa12/Rpb9/Rpc10/TFS  
IPR034014  Zn_ribbon_RPC11_C  
IPR001222  Znf_TFIIS  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0005730  C:nucleolus  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
GO:0006351  P:DNA-templated transcription  
GO:0042779  P:tRNA 3'-trailer cleavage  
Pfam View protein in Pfam  
PF01096  TFIIS_C  
PROSITE View protein in PROSITE  
PS00466  ZF_TFIIS_1  
PS51133  ZF_TFIIS_2  
CDD cd10509  Zn-ribbon_RPC11  
Amino Acid Sequences IALLSSNYCVKVIKNRIKKFNMKGITSSSLFNFCPICQSILLLTHSNNNSNILKCKNCNYFDDIALIKSEIFFKRKQTEQIVRKQSLASCHKQCDRCNNSMAYFHEMQTRSADEPMTIFYQCCRCQFMWKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.59
3 0.68
4 0.76
5 0.82
6 0.79
7 0.79
8 0.76
9 0.68
10 0.62
11 0.58
12 0.54
13 0.46
14 0.4
15 0.32
16 0.28
17 0.25
18 0.24
19 0.2
20 0.15
21 0.17
22 0.17
23 0.17
24 0.14
25 0.14
26 0.13
27 0.15
28 0.18
29 0.15
30 0.14
31 0.18
32 0.19
33 0.2
34 0.2
35 0.21
36 0.2
37 0.21
38 0.25
39 0.23
40 0.25
41 0.25
42 0.31
43 0.34
44 0.34
45 0.35
46 0.36
47 0.33
48 0.31
49 0.32
50 0.26
51 0.19
52 0.17
53 0.15
54 0.09
55 0.08
56 0.11
57 0.1
58 0.12
59 0.14
60 0.18
61 0.23
62 0.26
63 0.31
64 0.36
65 0.44
66 0.49
67 0.57
68 0.61
69 0.57
70 0.55
71 0.52
72 0.45
73 0.44
74 0.44
75 0.42
76 0.38
77 0.43
78 0.49
79 0.53
80 0.56
81 0.58
82 0.58
83 0.54
84 0.54
85 0.5
86 0.46
87 0.45
88 0.43
89 0.39
90 0.33
91 0.3
92 0.33
93 0.31
94 0.3
95 0.28
96 0.28
97 0.23
98 0.23
99 0.23
100 0.16
101 0.16
102 0.18
103 0.17
104 0.15
105 0.13
106 0.16
107 0.24
108 0.27
109 0.29
110 0.32
111 0.31