Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6FJ36

Protein Details
Accession Q6FJ36    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
164-186LDGTGKSNAKKRKNRSNGSSMATHydrophilic
NLS Segment(s)
PositionSequence
174-175KR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.333, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013942  Mediator_Med19_fun  
Gene Ontology GO:0070847  C:core mediator complex  
GO:0016592  C:mediator complex  
GO:0003713  F:transcription coactivator activity  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0032968  P:positive regulation of transcription elongation by RNA polymerase II  
GO:0060261  P:positive regulation of transcription initiation by RNA polymerase II  
GO:0051123  P:RNA polymerase II preinitiation complex assembly  
GO:0001113  P:transcription open complex formation at RNA polymerase II promoter  
KEGG cgr:CAGL0M09515g  -  
Pfam View protein in Pfam  
PF08633  Rox3  
Amino Acid Sequences MEMEEFAPSYYYYVEPEMGYQPQQPNPMEDLITVYHLDDISRQVARTNEDGTKAVKLRKSYKNQITDLSGKFSSIPNRENRKGGEIAHILFQNNPDMMNQVHRSPDMTDEQWREALMNVDASLFQAPNMDWEVCQSVLSQFDRSYPTEFQNDPNFHVDDLAFDLDGTGKSNAKKRKNRSNGSSMATPNSEMQDDVKRRRLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.15
4 0.18
5 0.18
6 0.19
7 0.23
8 0.26
9 0.29
10 0.35
11 0.33
12 0.33
13 0.34
14 0.34
15 0.29
16 0.24
17 0.22
18 0.17
19 0.18
20 0.15
21 0.12
22 0.12
23 0.11
24 0.11
25 0.1
26 0.11
27 0.13
28 0.14
29 0.13
30 0.15
31 0.17
32 0.2
33 0.22
34 0.23
35 0.22
36 0.23
37 0.24
38 0.23
39 0.26
40 0.26
41 0.28
42 0.28
43 0.32
44 0.38
45 0.46
46 0.54
47 0.59
48 0.64
49 0.67
50 0.66
51 0.63
52 0.59
53 0.56
54 0.48
55 0.42
56 0.33
57 0.26
58 0.25
59 0.24
60 0.26
61 0.24
62 0.27
63 0.32
64 0.4
65 0.43
66 0.45
67 0.44
68 0.42
69 0.4
70 0.36
71 0.32
72 0.26
73 0.24
74 0.23
75 0.22
76 0.18
77 0.16
78 0.16
79 0.12
80 0.1
81 0.1
82 0.07
83 0.08
84 0.08
85 0.12
86 0.12
87 0.12
88 0.13
89 0.12
90 0.13
91 0.13
92 0.15
93 0.14
94 0.14
95 0.18
96 0.19
97 0.2
98 0.19
99 0.18
100 0.16
101 0.14
102 0.14
103 0.09
104 0.08
105 0.07
106 0.07
107 0.07
108 0.07
109 0.07
110 0.05
111 0.05
112 0.06
113 0.05
114 0.07
115 0.09
116 0.09
117 0.08
118 0.1
119 0.12
120 0.11
121 0.11
122 0.1
123 0.09
124 0.13
125 0.14
126 0.14
127 0.13
128 0.15
129 0.18
130 0.2
131 0.23
132 0.21
133 0.23
134 0.27
135 0.27
136 0.3
137 0.36
138 0.36
139 0.35
140 0.36
141 0.34
142 0.28
143 0.29
144 0.23
145 0.15
146 0.16
147 0.14
148 0.1
149 0.09
150 0.09
151 0.09
152 0.09
153 0.11
154 0.1
155 0.12
156 0.16
157 0.24
158 0.33
159 0.43
160 0.53
161 0.6
162 0.7
163 0.78
164 0.84
165 0.85
166 0.85
167 0.81
168 0.77
169 0.74
170 0.65
171 0.58
172 0.5
173 0.43
174 0.36
175 0.31
176 0.26
177 0.2
178 0.21
179 0.27
180 0.34
181 0.39