Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0R0LYE6

Protein Details
Accession A0A0R0LYE6    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
73-119IEKKKLPKELQTKKTKKMRQKLTNEQMKKSCNGRSKFYRKNRLVYAYHydrophilic
NLS Segment(s)
PositionSequence
75-92KKKLPKELQTKKTKKMRQ
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
Amino Acid Sequences MLKLRASDLRLLTIEELETKYADVKTALLHVRQRMISSNATPVELHNCKRNISCVMTILREKRIEKIFKDCSIEKKKLPKELQTKKTKKMRQKLTNEQMKKSCNGRSKFYRKNRLVYAYMSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.17
3 0.16
4 0.13
5 0.13
6 0.12
7 0.13
8 0.13
9 0.13
10 0.11
11 0.1
12 0.1
13 0.15
14 0.18
15 0.19
16 0.23
17 0.24
18 0.28
19 0.28
20 0.28
21 0.26
22 0.27
23 0.26
24 0.24
25 0.27
26 0.23
27 0.23
28 0.22
29 0.19
30 0.23
31 0.24
32 0.25
33 0.26
34 0.27
35 0.27
36 0.28
37 0.3
38 0.26
39 0.26
40 0.25
41 0.22
42 0.22
43 0.23
44 0.25
45 0.24
46 0.24
47 0.24
48 0.24
49 0.26
50 0.3
51 0.32
52 0.31
53 0.37
54 0.38
55 0.37
56 0.42
57 0.39
58 0.42
59 0.46
60 0.48
61 0.45
62 0.5
63 0.52
64 0.57
65 0.59
66 0.58
67 0.62
68 0.68
69 0.74
70 0.75
71 0.77
72 0.77
73 0.83
74 0.82
75 0.81
76 0.81
77 0.82
78 0.81
79 0.84
80 0.86
81 0.87
82 0.89
83 0.83
84 0.8
85 0.75
86 0.68
87 0.63
88 0.57
89 0.55
90 0.54
91 0.53
92 0.55
93 0.6
94 0.67
95 0.73
96 0.78
97 0.81
98 0.78
99 0.82
100 0.82
101 0.78
102 0.71