Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0R0LR51

Protein Details
Accession A0A0R0LR51    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
86-117EEKIGEEKKNEKKKFKKGPEKKTCTNQRFIKQBasic
NLS Segment(s)
PositionSequence
51-57KKGIKKK
89-107IGEEKKNEKKKFKKGPEKK
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences TNNTVSNDDLALIKQFLISHPSKTKPIYPTFLLPNEKTKKSLTKWQTFANKKGIKKKRCREIYDCKEDIFLPKWGRFSLKKPSIYEEKIGEEKKNEKKKFKKGPEKKTCTNQRFIKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.16
5 0.17
6 0.22
7 0.27
8 0.31
9 0.34
10 0.37
11 0.42
12 0.43
13 0.47
14 0.45
15 0.42
16 0.43
17 0.43
18 0.47
19 0.46
20 0.4
21 0.44
22 0.46
23 0.44
24 0.42
25 0.41
26 0.42
27 0.41
28 0.49
29 0.49
30 0.51
31 0.52
32 0.57
33 0.64
34 0.61
35 0.61
36 0.62
37 0.59
38 0.55
39 0.63
40 0.65
41 0.65
42 0.7
43 0.75
44 0.74
45 0.77
46 0.79
47 0.76
48 0.78
49 0.78
50 0.76
51 0.68
52 0.58
53 0.51
54 0.44
55 0.39
56 0.3
57 0.27
58 0.21
59 0.22
60 0.23
61 0.23
62 0.28
63 0.27
64 0.3
65 0.35
66 0.4
67 0.43
68 0.43
69 0.49
70 0.52
71 0.52
72 0.51
73 0.42
74 0.39
75 0.4
76 0.41
77 0.37
78 0.34
79 0.4
80 0.47
81 0.55
82 0.58
83 0.62
84 0.7
85 0.79
86 0.85
87 0.88
88 0.89
89 0.89
90 0.93
91 0.94
92 0.93
93 0.91
94 0.9
95 0.9
96 0.86
97 0.85