Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0R0LQW3

Protein Details
Accession A0A0R0LQW3    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
95-116ILKGVSKKLRKQKTDNNGIKQEHydrophilic
119-140KPISEKQSGETKKRKSKKHTSEBasic
NLS Segment(s)
PositionSequence
126-137SGETKKRKSKKH
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 8.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045056  Nop56/Nop58  
IPR042239  Nop_C  
IPR002687  Nop_dom  
IPR036070  Nop_dom_sf  
Gene Ontology GO:0031428  C:box C/D RNP complex  
GO:0032040  C:small-subunit processome  
GO:0030515  F:snoRNA binding  
Pfam View protein in Pfam  
PF01798  Nop  
PROSITE View protein in PROSITE  
PS51358  NOP  
Amino Acid Sequences INLSKCTAGTIQVLGAEKALFRSLKSKTPTPKYGILKNNPYTTSPRIIRSLANKIAICARIDAFSKEKTDLYGIALKEAIINKIEKDIQIDTEEILKGVSKKLRKQKTDNNGIKQESVKPISEKQSGETKKRKSKKHTSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.13
4 0.12
5 0.12
6 0.15
7 0.12
8 0.11
9 0.18
10 0.2
11 0.28
12 0.33
13 0.39
14 0.45
15 0.54
16 0.59
17 0.58
18 0.63
19 0.61
20 0.65
21 0.66
22 0.64
23 0.65
24 0.64
25 0.63
26 0.56
27 0.53
28 0.49
29 0.44
30 0.44
31 0.37
32 0.35
33 0.33
34 0.33
35 0.34
36 0.34
37 0.38
38 0.34
39 0.36
40 0.33
41 0.31
42 0.33
43 0.3
44 0.25
45 0.19
46 0.16
47 0.13
48 0.14
49 0.15
50 0.14
51 0.15
52 0.16
53 0.16
54 0.15
55 0.14
56 0.14
57 0.12
58 0.12
59 0.15
60 0.13
61 0.12
62 0.12
63 0.11
64 0.12
65 0.13
66 0.11
67 0.08
68 0.09
69 0.08
70 0.11
71 0.12
72 0.1
73 0.12
74 0.12
75 0.12
76 0.13
77 0.14
78 0.12
79 0.13
80 0.13
81 0.1
82 0.09
83 0.09
84 0.09
85 0.12
86 0.18
87 0.22
88 0.3
89 0.4
90 0.5
91 0.56
92 0.64
93 0.71
94 0.76
95 0.81
96 0.82
97 0.8
98 0.78
99 0.72
100 0.66
101 0.58
102 0.53
103 0.49
104 0.43
105 0.38
106 0.35
107 0.38
108 0.42
109 0.45
110 0.41
111 0.37
112 0.44
113 0.48
114 0.54
115 0.58
116 0.62
117 0.67
118 0.75
119 0.81
120 0.81