Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0R0LT36

Protein Details
Accession A0A0R0LT36    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
47-71QSENFSRKKSPGRKRKLTKRASSVIHydrophilic
NLS Segment(s)
PositionSequence
53-66RKKSPGRKRKLTKR
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR002492  Transposase_Tc1-like  
Gene Ontology GO:0003677  F:DNA binding  
GO:0015074  P:DNA integration  
GO:0006313  P:DNA transposition  
Pfam View protein in Pfam  
PF01498  HTH_Tnp_Tc3_2  
Amino Acid Sequences MEYQKYSQADISRIHTLRDEKYSLSQIAHKTKWPKSSISFMLRTTNQSENFSRKKSPGRKRKLTKRASSVIQNIVNENPFATANIIRGVLKDKTGINISKQTLIRDMNRNGIRPYVARKKPALRKVNIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.36
3 0.37
4 0.37
5 0.39
6 0.36
7 0.29
8 0.33
9 0.36
10 0.32
11 0.3
12 0.31
13 0.33
14 0.38
15 0.38
16 0.4
17 0.43
18 0.47
19 0.53
20 0.51
21 0.48
22 0.44
23 0.5
24 0.51
25 0.5
26 0.47
27 0.41
28 0.44
29 0.4
30 0.39
31 0.36
32 0.34
33 0.3
34 0.3
35 0.32
36 0.34
37 0.37
38 0.37
39 0.36
40 0.35
41 0.42
42 0.49
43 0.57
44 0.6
45 0.65
46 0.73
47 0.81
48 0.88
49 0.88
50 0.87
51 0.84
52 0.8
53 0.75
54 0.67
55 0.62
56 0.55
57 0.5
58 0.44
59 0.37
60 0.31
61 0.27
62 0.24
63 0.19
64 0.15
65 0.1
66 0.08
67 0.08
68 0.09
69 0.08
70 0.08
71 0.09
72 0.1
73 0.09
74 0.1
75 0.13
76 0.12
77 0.13
78 0.14
79 0.13
80 0.16
81 0.2
82 0.21
83 0.21
84 0.27
85 0.28
86 0.32
87 0.33
88 0.32
89 0.33
90 0.35
91 0.37
92 0.39
93 0.4
94 0.43
95 0.46
96 0.47
97 0.44
98 0.42
99 0.39
100 0.34
101 0.4
102 0.42
103 0.44
104 0.47
105 0.53
106 0.6
107 0.68
108 0.75
109 0.76