Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0R0LRE3

Protein Details
Accession A0A0R0LRE3    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
101-124STYGCKKDRGTRPGKKVRCNKTHIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11.333, cyto_mito 4.333, cyto 4, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001266  Ribosomal_S19e  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01090  Ribosomal_S19e  
Amino Acid Sequences MSETNLVYTVDPVSLITCINSHLSNNDLLTRPKYFNILKTSVGKQNAPIQNDWLYTRAASLLRKIACFSYKKSDNNYKNLLSKKTKSKDRSDYFNIMTILSTYGCKKDRGTRPGKKVRCNKTHIISILEDFKKLNWIKKTTDGHFLLTEAGLEFINEMVGKCQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.07
5 0.09
6 0.11
7 0.12
8 0.12
9 0.13
10 0.14
11 0.16
12 0.16
13 0.18
14 0.19
15 0.21
16 0.24
17 0.26
18 0.27
19 0.25
20 0.31
21 0.3
22 0.33
23 0.37
24 0.37
25 0.36
26 0.39
27 0.43
28 0.42
29 0.43
30 0.37
31 0.33
32 0.39
33 0.4
34 0.38
35 0.34
36 0.31
37 0.31
38 0.31
39 0.29
40 0.21
41 0.17
42 0.14
43 0.14
44 0.13
45 0.12
46 0.12
47 0.13
48 0.17
49 0.18
50 0.18
51 0.19
52 0.19
53 0.21
54 0.22
55 0.24
56 0.27
57 0.33
58 0.35
59 0.41
60 0.5
61 0.5
62 0.54
63 0.55
64 0.49
65 0.48
66 0.49
67 0.49
68 0.44
69 0.44
70 0.48
71 0.51
72 0.56
73 0.57
74 0.61
75 0.65
76 0.64
77 0.66
78 0.63
79 0.6
80 0.53
81 0.51
82 0.42
83 0.32
84 0.28
85 0.21
86 0.15
87 0.11
88 0.11
89 0.08
90 0.12
91 0.14
92 0.15
93 0.17
94 0.26
95 0.35
96 0.44
97 0.53
98 0.58
99 0.67
100 0.76
101 0.81
102 0.81
103 0.82
104 0.83
105 0.81
106 0.78
107 0.76
108 0.71
109 0.7
110 0.63
111 0.56
112 0.48
113 0.41
114 0.43
115 0.36
116 0.31
117 0.24
118 0.22
119 0.28
120 0.29
121 0.34
122 0.33
123 0.37
124 0.4
125 0.49
126 0.56
127 0.51
128 0.57
129 0.52
130 0.47
131 0.43
132 0.4
133 0.32
134 0.24
135 0.22
136 0.13
137 0.12
138 0.08
139 0.07
140 0.07
141 0.06
142 0.07
143 0.07
144 0.07