Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0R0M8F8

Protein Details
Accession A0A0R0M8F8    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
61-101PMDSARKTDKRQRLLRKKGNIGYKPKKKGERKRKSVRGAVIBasic
NLS Segment(s)
PositionSequence
66-97RKTDKRQRLLRKKGNIGYKPKKKGERKRKSVR
Subcellular Location(s) nucl 17, cyto_nucl 13.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001377  Ribosomal_S6e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
Amino Acid Sequences MKLNIASPQTNSIICIEVTGNIERSLYGKSLGDVIDAGLLKPEFAGWQVQFTGGSDKQGFPMDSARKTDKRQRLLRKKGNIGYKPKKKGERKRKSVRGAVISEEIAVLCMKIVNDPIQLPDPEATGPEAKHIEGLTDGDKIGSHLPKRLTKLHRELFSHVPNFKELNENQIREHVKTLVAQKSDSKKQMPRLRVTRIRSPHFQERLQKRLDDNQKRKEKSEAIKAEFLQKYPGWKIAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.14
4 0.14
5 0.16
6 0.17
7 0.17
8 0.16
9 0.16
10 0.15
11 0.15
12 0.15
13 0.13
14 0.13
15 0.12
16 0.12
17 0.15
18 0.14
19 0.14
20 0.11
21 0.11
22 0.12
23 0.12
24 0.11
25 0.11
26 0.11
27 0.11
28 0.1
29 0.1
30 0.07
31 0.08
32 0.13
33 0.11
34 0.13
35 0.13
36 0.14
37 0.14
38 0.14
39 0.2
40 0.15
41 0.19
42 0.18
43 0.18
44 0.2
45 0.23
46 0.22
47 0.17
48 0.24
49 0.26
50 0.27
51 0.31
52 0.36
53 0.38
54 0.44
55 0.52
56 0.53
57 0.58
58 0.65
59 0.72
60 0.76
61 0.82
62 0.86
63 0.85
64 0.84
65 0.81
66 0.81
67 0.77
68 0.77
69 0.77
70 0.77
71 0.76
72 0.75
73 0.79
74 0.8
75 0.83
76 0.84
77 0.84
78 0.86
79 0.88
80 0.91
81 0.88
82 0.85
83 0.8
84 0.75
85 0.65
86 0.56
87 0.47
88 0.37
89 0.29
90 0.22
91 0.15
92 0.09
93 0.08
94 0.05
95 0.03
96 0.04
97 0.04
98 0.04
99 0.05
100 0.06
101 0.07
102 0.07
103 0.09
104 0.1
105 0.1
106 0.11
107 0.1
108 0.1
109 0.09
110 0.09
111 0.09
112 0.08
113 0.08
114 0.1
115 0.1
116 0.09
117 0.11
118 0.1
119 0.09
120 0.08
121 0.09
122 0.08
123 0.08
124 0.08
125 0.07
126 0.07
127 0.07
128 0.1
129 0.13
130 0.13
131 0.17
132 0.21
133 0.26
134 0.3
135 0.38
136 0.4
137 0.44
138 0.53
139 0.56
140 0.56
141 0.55
142 0.56
143 0.54
144 0.55
145 0.51
146 0.43
147 0.38
148 0.35
149 0.33
150 0.29
151 0.29
152 0.22
153 0.27
154 0.32
155 0.32
156 0.3
157 0.37
158 0.39
159 0.33
160 0.35
161 0.27
162 0.21
163 0.24
164 0.3
165 0.29
166 0.28
167 0.28
168 0.33
169 0.39
170 0.45
171 0.47
172 0.47
173 0.47
174 0.56
175 0.63
176 0.64
177 0.66
178 0.67
179 0.72
180 0.74
181 0.74
182 0.73
183 0.74
184 0.72
185 0.7
186 0.7
187 0.7
188 0.68
189 0.68
190 0.68
191 0.68
192 0.69
193 0.66
194 0.62
195 0.55
196 0.6
197 0.64
198 0.65
199 0.67
200 0.7
201 0.76
202 0.77
203 0.76
204 0.74
205 0.72
206 0.69
207 0.7
208 0.69
209 0.65
210 0.67
211 0.65
212 0.66
213 0.59
214 0.52
215 0.47
216 0.38
217 0.39
218 0.37