Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0R0M369

Protein Details
Accession A0A0R0M369    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
26-45SVIEKCKKKIKNKLYSLVNRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.833, nucl 11.5, cyto 11, cyto_pero 6.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR025659  Tubby-like_C  
IPR000007  Tubby_C  
Pfam View protein in Pfam  
PF01167  Tub  
Amino Acid Sequences MKFKNVVINDMCFRTIQVHLDFENGSVIEKCKKKIKNKLYSLVNRMPKYDAIKDIYTLKFDEKEVVPSFRNFQLVCPQMPDHLTLSLGMVNFKKWAISHSFPWNATQAFSIALSAIVSDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.21
4 0.2
5 0.21
6 0.21
7 0.23
8 0.22
9 0.19
10 0.19
11 0.14
12 0.13
13 0.11
14 0.13
15 0.18
16 0.21
17 0.24
18 0.31
19 0.39
20 0.48
21 0.58
22 0.67
23 0.7
24 0.75
25 0.8
26 0.81
27 0.8
28 0.77
29 0.74
30 0.71
31 0.61
32 0.55
33 0.48
34 0.41
35 0.39
36 0.34
37 0.29
38 0.25
39 0.25
40 0.25
41 0.27
42 0.25
43 0.22
44 0.2
45 0.17
46 0.15
47 0.14
48 0.16
49 0.12
50 0.16
51 0.16
52 0.18
53 0.18
54 0.18
55 0.21
56 0.19
57 0.22
58 0.17
59 0.17
60 0.23
61 0.24
62 0.23
63 0.23
64 0.22
65 0.21
66 0.22
67 0.22
68 0.16
69 0.14
70 0.14
71 0.11
72 0.11
73 0.11
74 0.1
75 0.11
76 0.1
77 0.1
78 0.11
79 0.11
80 0.11
81 0.1
82 0.13
83 0.19
84 0.22
85 0.27
86 0.35
87 0.4
88 0.39
89 0.42
90 0.42
91 0.35
92 0.32
93 0.28
94 0.19
95 0.16
96 0.15
97 0.13
98 0.09
99 0.09
100 0.08