Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6FT67

Protein Details
Accession Q6FT67    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-51MPQKPLKVTKKAKDPRRVTKKQKNLRKAAPIQIKSKKKSLRHLKKLSKTSSHydrophilic
NLS Segment(s)
PositionSequence
6-46LKVTKKAKDPRRVTKKQKNLRKAAPIQIKSKKKSLRHLKKL
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
KEGG cgr:CAGL0G04983g  -  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MPQKPLKVTKKAKDPRRVTKKQKNLRKAAPIQIKSKKKSLRHLKKLSKTSSLTEATERLVASKVGHLELLRGTRKEIEAANKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.87
4 0.89
5 0.89
6 0.9
7 0.91
8 0.91
9 0.91
10 0.9
11 0.88
12 0.85
13 0.84
14 0.79
15 0.77
16 0.77
17 0.71
18 0.69
19 0.7
20 0.7
21 0.63
22 0.66
23 0.64
24 0.59
25 0.65
26 0.68
27 0.7
28 0.73
29 0.8
30 0.81
31 0.83
32 0.85
33 0.78
34 0.73
35 0.64
36 0.56
37 0.51
38 0.44
39 0.37
40 0.3
41 0.27
42 0.22
43 0.21
44 0.18
45 0.14
46 0.12
47 0.12
48 0.11
49 0.13
50 0.13
51 0.12
52 0.13
53 0.12
54 0.13
55 0.16
56 0.21
57 0.23
58 0.22
59 0.24
60 0.26
61 0.27
62 0.29
63 0.3
64 0.35