Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0R0LU09

Protein Details
Accession A0A0R0LU09    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
48-68RPENPRPPRERSKRDKFIRSIBasic
NLS Segment(s)
PositionSequence
58-58R
Subcellular Location(s) nucl 16, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MVRFSAEEEFMKSCYPASSPGGGISCLQMVCGKFVLLGDPYAFFFGVRPENPRPPRERSKRDKFIRSIFVCHAERGFTPGKQVNRLIFQPFFYLSNYQYFLSKQKFSQKNKFFFPRFDHINRSEFNSSSFVDELRHRRCSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.16
4 0.18
5 0.19
6 0.19
7 0.21
8 0.22
9 0.21
10 0.2
11 0.17
12 0.15
13 0.12
14 0.12
15 0.12
16 0.12
17 0.12
18 0.12
19 0.11
20 0.1
21 0.1
22 0.11
23 0.09
24 0.09
25 0.08
26 0.09
27 0.09
28 0.1
29 0.1
30 0.08
31 0.07
32 0.09
33 0.13
34 0.13
35 0.19
36 0.23
37 0.33
38 0.37
39 0.43
40 0.45
41 0.49
42 0.59
43 0.63
44 0.68
45 0.69
46 0.75
47 0.8
48 0.82
49 0.83
50 0.77
51 0.73
52 0.72
53 0.63
54 0.56
55 0.47
56 0.46
57 0.38
58 0.33
59 0.27
60 0.19
61 0.17
62 0.18
63 0.19
64 0.12
65 0.16
66 0.2
67 0.22
68 0.24
69 0.27
70 0.24
71 0.26
72 0.28
73 0.27
74 0.23
75 0.22
76 0.21
77 0.19
78 0.18
79 0.17
80 0.17
81 0.14
82 0.17
83 0.18
84 0.17
85 0.17
86 0.17
87 0.22
88 0.25
89 0.26
90 0.26
91 0.35
92 0.44
93 0.51
94 0.61
95 0.64
96 0.65
97 0.71
98 0.77
99 0.7
100 0.67
101 0.66
102 0.63
103 0.62
104 0.6
105 0.59
106 0.53
107 0.55
108 0.5
109 0.5
110 0.45
111 0.38
112 0.36
113 0.32
114 0.29
115 0.27
116 0.27
117 0.2
118 0.2
119 0.27
120 0.33
121 0.36