Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0R0M491

Protein Details
Accession A0A0R0M491    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
54-84AISYLKKGNDKKCKKFLRKRLGSLKAAKKKMHydrophilic
NLS Segment(s)
PositionSequence
11-23KHKVVKLNLKKKD
60-83KGNDKKCKKFLRKRLGSLKAAKKK
Subcellular Location(s) mito 13, nucl 12.5, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
Amino Acid Sequences MILNQKARALKHKVVKLNLKKKDKSALFKPSENKLLARSIVSEICGKAPYELMAISYLKKGNDKKCKKFLRKRLGSLKAAKKKMDILS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.72
3 0.74
4 0.76
5 0.79
6 0.79
7 0.75
8 0.72
9 0.74
10 0.7
11 0.67
12 0.65
13 0.66
14 0.61
15 0.63
16 0.63
17 0.58
18 0.56
19 0.49
20 0.42
21 0.34
22 0.31
23 0.26
24 0.22
25 0.19
26 0.15
27 0.14
28 0.14
29 0.13
30 0.11
31 0.11
32 0.11
33 0.1
34 0.09
35 0.08
36 0.08
37 0.07
38 0.07
39 0.07
40 0.08
41 0.08
42 0.09
43 0.11
44 0.12
45 0.12
46 0.18
47 0.25
48 0.33
49 0.43
50 0.53
51 0.6
52 0.69
53 0.79
54 0.84
55 0.88
56 0.89
57 0.9
58 0.89
59 0.9
60 0.9
61 0.88
62 0.85
63 0.84
64 0.84
65 0.83
66 0.79
67 0.71
68 0.64