Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0R0LRQ6

Protein Details
Accession A0A0R0LRQ6    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-66KTYDQDKKRTIKTKNVRSRQKTYDQDKKRTIKTKNVRSRQKTYDQDKKRAIKTKNVRSRQKTYDQDHydrophilic
NLS Segment(s)
PositionSequence
27-60KKRTIKTKNVRSRQKTYDQDKKRAIKTKNVRSRQ
Subcellular Location(s) nucl 23, mito 3
Family & Domain DBs
Amino Acid Sequences KTYDQDKKRTIKTKNVRSRQKTYDQDKKRTIKTKNVRSRQKTYDQDKKRAIKTKNVRSRQKTYDQDKKRTIRTNTFKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.85
5 0.87
6 0.83
7 0.82
8 0.81
9 0.79
10 0.79
11 0.77
12 0.78
13 0.79
14 0.8
15 0.8
16 0.79
17 0.77
18 0.77
19 0.79
20 0.81
21 0.83
22 0.85
23 0.86
24 0.85
25 0.87
26 0.83
27 0.82
28 0.81
29 0.79
30 0.79
31 0.75
32 0.76
33 0.76
34 0.75
35 0.72
36 0.72
37 0.65
38 0.65
39 0.69
40 0.71
41 0.74
42 0.77
43 0.79
44 0.79
45 0.84
46 0.81
47 0.8
48 0.79
49 0.78
50 0.79
51 0.77
52 0.78
53 0.79
54 0.79
55 0.78
56 0.78
57 0.77
58 0.78