Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0R0M0H8

Protein Details
Accession A0A0R0M0H8    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
92-117MYPTNKKVRVYRCKGGKFKKQHIVGTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 3.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
IPR002492  Transposase_Tc1-like  
Gene Ontology GO:0003677  F:DNA binding  
GO:0015074  P:DNA integration  
GO:0006313  P:DNA transposition  
Pfam View protein in Pfam  
PF01498  HTH_Tnp_Tc3_2  
Amino Acid Sequences CAVIQNIVNKNTFATANIIRGILKDKTGINISKQTLIRDMNRNGIRPYVFRKKPALRKVNITKKHQFSIKYCGMVDSFWENVISSDECKFEMYPTNKKVRVYRCKGGKFKKQHIVGTSQNCGYKVMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.2
4 0.21
5 0.2
6 0.18
7 0.19
8 0.22
9 0.17
10 0.16
11 0.16
12 0.16
13 0.19
14 0.23
15 0.25
16 0.24
17 0.29
18 0.3
19 0.34
20 0.35
21 0.33
22 0.32
23 0.34
24 0.35
25 0.37
26 0.37
27 0.4
28 0.41
29 0.42
30 0.38
31 0.38
32 0.33
33 0.28
34 0.34
35 0.35
36 0.35
37 0.37
38 0.44
39 0.5
40 0.58
41 0.65
42 0.66
43 0.58
44 0.65
45 0.71
46 0.73
47 0.72
48 0.7
49 0.68
50 0.62
51 0.63
52 0.57
53 0.51
54 0.44
55 0.44
56 0.4
57 0.34
58 0.31
59 0.29
60 0.25
61 0.21
62 0.2
63 0.14
64 0.11
65 0.1
66 0.1
67 0.09
68 0.09
69 0.11
70 0.1
71 0.09
72 0.1
73 0.11
74 0.11
75 0.12
76 0.12
77 0.11
78 0.19
79 0.24
80 0.31
81 0.37
82 0.45
83 0.47
84 0.51
85 0.57
86 0.59
87 0.64
88 0.64
89 0.67
90 0.68
91 0.75
92 0.81
93 0.83
94 0.83
95 0.82
96 0.84
97 0.84
98 0.81
99 0.77
100 0.71
101 0.69
102 0.67
103 0.64
104 0.59
105 0.53
106 0.5
107 0.44