Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0R0M1L1

Protein Details
Accession A0A0R0M1L1    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
18-68FCVRCGKTSYHKQKRKCAACAYPEKKLKRNTNYKAKQRRTVNQRNRYLKKIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences MSKGTSSFGKKNKHNHTFCVRCGKTSYHKQKRKCAACAYPEKKLKRNTNYKAKQRRTVNQRNRYLKKITSASKNGFKGETLINQLKVKYNISN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.73
3 0.76
4 0.73
5 0.71
6 0.72
7 0.61
8 0.53
9 0.53
10 0.5
11 0.48
12 0.53
13 0.59
14 0.59
15 0.67
16 0.72
17 0.78
18 0.83
19 0.82
20 0.77
21 0.74
22 0.69
23 0.7
24 0.73
25 0.67
26 0.65
27 0.65
28 0.63
29 0.61
30 0.63
31 0.64
32 0.62
33 0.69
34 0.68
35 0.72
36 0.77
37 0.81
38 0.83
39 0.8
40 0.8
41 0.76
42 0.77
43 0.76
44 0.79
45 0.79
46 0.78
47 0.82
48 0.84
49 0.82
50 0.78
51 0.73
52 0.64
53 0.61
54 0.58
55 0.55
56 0.53
57 0.55
58 0.57
59 0.6
60 0.59
61 0.54
62 0.47
63 0.41
64 0.35
65 0.32
66 0.29
67 0.29
68 0.31
69 0.33
70 0.35
71 0.36
72 0.39
73 0.39