Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0R0LYU4

Protein Details
Accession A0A0R0LYU4    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
133-153RLKVVKCKKTLDYKWRIKDFLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 14, cyto 9.5
Family & Domain DBs
PROSITE View protein in PROSITE  
PS50231  RICIN_B_LECTIN  
Amino Acid Sequences MFFFAILLNVKANLDQGSKLIEMQSNKYAFITDLGRAVRVQSNKDDPDSSEAKSVLHLVRKADEKFYIQFSSERFLCVKEDSDKVVSCENETDKNTLWEVVPGDDDGYALKTIDNKCLRIGAFDNKKFSKGLRLKVVKCKKTLDYKWRIKDFLLDSNEYEGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.12
4 0.15
5 0.15
6 0.15
7 0.16
8 0.18
9 0.19
10 0.22
11 0.28
12 0.26
13 0.26
14 0.25
15 0.24
16 0.2
17 0.21
18 0.19
19 0.12
20 0.16
21 0.16
22 0.17
23 0.16
24 0.18
25 0.2
26 0.21
27 0.23
28 0.24
29 0.31
30 0.32
31 0.34
32 0.33
33 0.29
34 0.32
35 0.31
36 0.26
37 0.22
38 0.2
39 0.18
40 0.18
41 0.2
42 0.17
43 0.19
44 0.2
45 0.18
46 0.21
47 0.26
48 0.27
49 0.25
50 0.24
51 0.22
52 0.22
53 0.25
54 0.22
55 0.18
56 0.19
57 0.17
58 0.2
59 0.17
60 0.17
61 0.14
62 0.14
63 0.14
64 0.14
65 0.15
66 0.14
67 0.15
68 0.15
69 0.17
70 0.16
71 0.16
72 0.18
73 0.16
74 0.14
75 0.15
76 0.15
77 0.17
78 0.18
79 0.19
80 0.16
81 0.18
82 0.18
83 0.16
84 0.14
85 0.12
86 0.11
87 0.1
88 0.1
89 0.08
90 0.08
91 0.07
92 0.07
93 0.06
94 0.06
95 0.06
96 0.06
97 0.06
98 0.11
99 0.12
100 0.21
101 0.24
102 0.23
103 0.24
104 0.27
105 0.27
106 0.25
107 0.28
108 0.29
109 0.36
110 0.39
111 0.46
112 0.44
113 0.45
114 0.43
115 0.4
116 0.41
117 0.38
118 0.42
119 0.46
120 0.54
121 0.58
122 0.68
123 0.78
124 0.73
125 0.7
126 0.68
127 0.65
128 0.67
129 0.71
130 0.71
131 0.71
132 0.76
133 0.81
134 0.82
135 0.76
136 0.66
137 0.65
138 0.58
139 0.56
140 0.52
141 0.44
142 0.39